Comparing 200821 FitnessBrowser__MR1:200821 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7p7wBBB Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
40% identity, 98% coverage: 5:303/306 of query aligns to 8:304/306 of 7p7wBBB
7p9lAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
40% identity, 98% coverage: 5:303/306 of query aligns to 5:301/303 of 7p9lAAA
7p9pAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
40% identity, 98% coverage: 5:303/306 of query aligns to 6:302/304 of 7p9pAAA
Q8ZPZ9 N-acetyl-D-glucosamine kinase; GlcNAc kinase; EC 2.7.1.59 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
40% identity, 98% coverage: 5:303/306 of query aligns to 4:299/303 of Q8ZPZ9
2ap1A Crystal structure of the putative regulatory protein
40% identity, 98% coverage: 5:303/306 of query aligns to 6:301/305 of 2ap1A
4db3A 1.95 angstrom resolution crystal structure of n-acetyl-d-glucosamine kinase from vibrio vulnificus.
35% identity, 99% coverage: 2:303/306 of query aligns to 9:307/311 of 4db3A
P32718 D-allose kinase; Allokinase; EC 2.7.1.55 from Escherichia coli (strain K12) (see paper)
28% identity, 97% coverage: 5:300/306 of query aligns to 10:289/309 of P32718
2qm1B Crystal structure of glucokinase from enterococcus faecalis
29% identity, 98% coverage: 4:303/306 of query aligns to 9:318/325 of 2qm1B
2gupA Structural genomics, the crystal structure of a rok family protein from streptococcus pneumoniae tigr4 in complex with sucrose
27% identity, 98% coverage: 6:306/306 of query aligns to 6:286/289 of 2gupA
1z05A Crystal structure of the rok family transcriptional regulator, homolog of e.Coli mlc protein.
27% identity, 82% coverage: 40:289/306 of query aligns to 119:359/396 of 1z05A
3vglA Crystal structure of a rok family glucokinase from streptomyces griseus in complex with glucose and amppnp (see paper)
29% identity, 98% coverage: 2:301/306 of query aligns to 2:306/312 of 3vglA
3vgkB Crystal structure of a rok family glucokinase from streptomyces griseus (see paper)
29% identity, 98% coverage: 2:301/306 of query aligns to 2:306/312 of 3vgkB
6jdbA Crystal structure of n-acetyl mannosmaine kinase in complex with mannac-6p and adp from haemophilus influenzae
26% identity, 99% coverage: 4:306/306 of query aligns to 4:286/290 of 6jdbA
6jdoA Crystal structure of n-acetyl mannosmaine kinase with amp-pnp from pasteurella multocida
27% identity, 99% coverage: 1:302/306 of query aligns to 1:284/293 of 6jdoA
6jdhA Crystal structure of n-acetyl mannosmaine kinase from pasteurella multocida
27% identity, 99% coverage: 1:302/306 of query aligns to 1:284/293 of 6jdhA
3vovB Crystal structure of rok hexokinase from thermus thermophilus (see paper)
30% identity, 98% coverage: 1:301/306 of query aligns to 1:288/298 of 3vovB
5f7qE Rok repressor lmo0178 from listeria monocytogenes bound to operator (see paper)
23% identity, 80% coverage: 60:303/306 of query aligns to 145:384/396 of 5f7qE
Sites not aligning to the query:
Q93LQ8 Beta-glucoside kinase; EC 2.7.1.85 from Klebsiella pneumoniae (see paper)
25% identity, 83% coverage: 6:259/306 of query aligns to 6:244/297 of Q93LQ8
P50456 DNA-binding transcriptional repressor Mlc; Making large colonies protein; Membrane linked control from Escherichia coli (strain K12) (see 4 papers)
26% identity, 71% coverage: 51:267/306 of query aligns to 140:353/406 of P50456
Sites not aligning to the query:
1z6rA Crystal structure of mlc from escherichia coli (see paper)
26% identity, 71% coverage: 51:267/306 of query aligns to 116:329/382 of 1z6rA
>200821 FitnessBrowser__MR1:200821
MIRMGIDLGGTKIELVALNNEGNEVVRKRINTPRDYQGTLNAIVDLVNEAESTLGEKGSV
GVGIPGVISPYSGLVKNANSTWINGHPLDVHLGELLGREVRVANDANCFALSEAVDGAAA
GKSVVFGVIIGTGCGAGVAINGKVHAGGNGIGGEWGHNPLPWMTKEEFNTTRCFCGNPDC
IETFISGTGFVRDYNEALSRAASVQRVPAKSGSEIMSLVDGGDEIALAAFERYVDRLARS
LAHVINLLDPDAIVLGGGMSNVEAIYPRLPALLSHYVVGRECRTPVVQNLYGCSSGVRGA
AWLWEK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory