Comparing 200830 FitnessBrowser__MR1:200830 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6knlA Uridine and triphosphate-bound ugpase from acinetobacter baumannii
58% identity, 96% coverage: 6:294/302 of query aligns to 2:286/290 of 6knlA
6k8dA Udp-glucose pyrophosphorylase with upg from acinetobacter baumanii
58% identity, 96% coverage: 6:294/302 of query aligns to 2:286/290 of 6k8dA
6ikzB Udp-glucose pyrophosphorylase from acinetobacter baumanii
57% identity, 96% coverage: 6:294/302 of query aligns to 2:281/285 of 6ikzB
5ve7A Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp
52% identity, 97% coverage: 5:296/302 of query aligns to 2:281/282 of 5ve7A
5i1fA Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate- glucose
51% identity, 96% coverage: 5:294/302 of query aligns to 4:285/290 of 5i1fA
2ux8G Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
43% identity, 93% coverage: 6:286/302 of query aligns to 5:275/288 of 2ux8G
8f73E Crystal structure of pseudomonas aeruginosa udp-glucose phosphorylase in complex with udp-glucose
43% identity, 90% coverage: 6:276/302 of query aligns to 8:271/281 of 8f73E
3jukD The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
42% identity, 91% coverage: 6:279/302 of query aligns to 2:260/264 of 3jukD
3jukA The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
42% identity, 91% coverage: 6:279/302 of query aligns to 2:260/265 of 3jukA
8b6dA Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp
39% identity, 95% coverage: 9:294/302 of query aligns to 5:284/291 of 8b6dA
2ux8A Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
38% identity, 93% coverage: 6:286/302 of query aligns to 5:242/255 of 2ux8A
8b68A Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp-glucose
37% identity, 95% coverage: 9:294/302 of query aligns to 5:279/286 of 8b68A
2pa4B Crystal structure of udp-glucose pyrophosphorylase from corynebacteria glutamicum in complex with magnesium and udp-glucose (see paper)
36% identity, 98% coverage: 4:298/302 of query aligns to 1:290/299 of 2pa4B
3zllA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
27% identity, 80% coverage: 3:243/302 of query aligns to 3:205/297 of 3zllA
Sites not aligning to the query:
3zlkA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
27% identity, 80% coverage: 3:243/302 of query aligns to 3:205/297 of 3zlkA
Sites not aligning to the query:
5fyeA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
27% identity, 80% coverage: 3:243/302 of query aligns to 2:204/296 of 5fyeA
Sites not aligning to the query:
5fu0A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
27% identity, 80% coverage: 3:243/302 of query aligns to 2:204/296 of 5fu0A
Sites not aligning to the query:
5ftvA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
27% identity, 80% coverage: 3:243/302 of query aligns to 2:204/296 of 5ftvA
Sites not aligning to the query:
5ftsA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
27% identity, 80% coverage: 3:243/302 of query aligns to 2:204/296 of 5ftsA
Sites not aligning to the query:
5fu8A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
27% identity, 80% coverage: 3:243/302 of query aligns to 3:205/297 of 5fu8A
Sites not aligning to the query:
>200830 FitnessBrowser__MR1:200830
MKQHQIRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSEAIAAGIKEIVLVTH
ASKNSIENHFDTSFELEAQLERRVKRQLLEAVQSICPKDVTVISVRQSQAKGLGHAILCA
KSVVGDAPFAVLLPDVIIDEASCDLKTDNLASMVSLFDETQVGQIMVEGVPHHLVNQYGI
ADVNGHDLQPGESEPLVELVEKPPVDEAPSNLAVVGRYVLPAAIWPLLAKTPAGAGDEIQ
LTDAIAMLMKEETVNAYYMQGKSHDCGNKQGYMRANVEYALRHSEIGEDFAHYLKTVVKG
IK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory