SitesBLAST
Comparing 200847 FitnessBrowser__MR1:200847 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9I5I6 NAD-dependent L-serine dehydrogenase; L-serine 3-dehydrogenase (NAD(+)); EC 1.1.1.387 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
57% identity, 100% coverage: 1:299/300 of query aligns to 1:296/298 of Q9I5I6
- 2:31 (vs. 2:31, 67% identical) binding
- P66 (= P66) binding
- T96 (= T99) binding ; mutation to A: Almost abolished activity.
- S122 (= S125) mutation to A: Strongly reduced activity.
- K171 (= K174) active site
- N175 (= N178) mutation to A: Strongly reduced activity.
- W214 (= W217) mutation to A: Almost abolished activity.
- Y219 (= Y222) mutation to A: Strongly reduced activity.
- K246 (= K249) binding ; mutation to A: Almost abolished activity.
- D247 (= D250) mutation to A: Almost abolished activity.
3q3cA Crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with NAD (see paper)
57% identity, 98% coverage: 4:297/300 of query aligns to 3:292/294 of 3q3cA
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), H10 (≠ N11), M11 (= M12), F29 (= F30), D30 (= D31), L31 (= L32), M63 (= M64), L64 (= L65), P65 (= P66), T94 (= T99), V119 (= V124), G121 (= G126), F237 (= F242), K244 (= K249)
3obbA Crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1 (see paper)
57% identity, 99% coverage: 1:297/300 of query aligns to 1:293/295 of 3obbA
P29266 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Rattus norvegicus (Rat) (see paper)
45% identity, 97% coverage: 2:293/300 of query aligns to 39:327/335 of P29266
- D68 (= D31) mutation to R: Decrease of activity with NAD, increase of activity with NADP.
- K208 (= K174) mutation K->A,H,N,R: Complete loss of activity.
- N212 (= N178) mutation to Q: Decrease in activity.
P31937 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Homo sapiens (Human) (see paper)
45% identity, 97% coverage: 2:293/300 of query aligns to 40:328/336 of P31937
- 40:68 (vs. 2:30, 55% identical) binding
- LP 103:104 (= LP 65:66) binding
- N108 (≠ H70) binding
- T134 (= T99) binding
- K284 (= K249) binding
Sites not aligning to the query:
- 1:36 modified: transit peptide, Mitochondrion
2i9pB Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
46% identity, 97% coverage: 4:293/300 of query aligns to 3:289/296 of 2i9pB
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), N10 (= N11), M11 (= M12), Y29 (≠ F30), D30 (= D31), V31 (≠ L32), M63 (= M64), L64 (= L65), P65 (= P66), T95 (= T99), V120 (= V124), G122 (= G126), F238 (= F242), K245 (= K249)
5y8lB Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + NAD +(s)-3-hydroxyisobutyrate (s-hiba) (see paper)
40% identity, 98% coverage: 1:295/300 of query aligns to 1:288/290 of 5y8lB
- binding (2~{S})-2-methylpentanedioic acid: T129 (= T135), E149 (≠ N155), A152 (≠ G158), G153 (≠ K159), G153 (≠ K159), K154 (≠ N160)
- binding (2S)-2-methyl-3-oxidanyl-propanoic acid: S119 (= S125), G120 (= G126), W211 (= W217), F236 (= F242)
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G10 (= G10), N11 (= N11), M12 (= M12), F30 (= F30), D31 (= D31), P32 (≠ L32), M64 (= M64), L65 (= L65), T93 (= T99), G121 (= G127), K168 (= K174), L240 (= L246), K243 (= K249)
5y8kA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + l-serine (see paper)
40% identity, 98% coverage: 1:295/300 of query aligns to 1:288/290 of 5y8kA
5y8hA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + NAD+ (see paper)
40% identity, 98% coverage: 2:295/300 of query aligns to 1:287/291 of 5y8hA
- binding (2~{S})-2-methylpentanedioic acid: R144 (≠ Q151), E148 (≠ N155), A151 (≠ G158), K153 (≠ N160)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G9 (= G10), N10 (= N11), M11 (= M12), F29 (= F30), D30 (= D31), P31 (≠ L32), M63 (= M64), L64 (= L65), G120 (= G127), L239 (= L246), K242 (= K249)
5y8iA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + (s)-3-hydroxyisobutyrate (s-hiba) (see paper)
40% identity, 98% coverage: 2:295/300 of query aligns to 1:287/292 of 5y8iA
P0A9V8 3-sulfolactaldehyde reductase; SLA reductase; 4-hydroxybutyrate dehydrogenase; Gamma-hydroxybutyrate dehydrogenase; GHBDH; Succinic semialdehyde reductase; SSA reductase; EC 1.1.1.373; EC 1.1.1.61 from Escherichia coli (strain K12)
37% identity, 98% coverage: 1:294/300 of query aligns to 1:285/298 of P0A9V8
- QM 11:12 (≠ NM 11:12) binding
- D31 (= D31) binding
- L65 (= L65) binding
- T96 (= T99) binding
- G122 (≠ S125) mutation to S: 25-fold decrease in catalytic efficiency with SLA as substrate. 5-fold decrease in catalytic efficiency with NADH as substrate.
- R123 (≠ G126) binding ; mutation to G: 130-fold decrease in catalytic efficiency with SLA as substrate. 3-fold decrease in catalytic efficiency with NADH as substrate.
- T124 (≠ G127) mutation to G: 230-fold decrease in catalytic efficiency with SLA as substrate. 12-fold decrease in catalytic efficiency with NADH as substrate.
- NNYMS 174:178 (≠ NNMLL 177:181) binding
- K240 (= K249) binding
6smyA Crystal structure of sla reductase yihu from e. Coli with nadh and product dhps
37% identity, 98% coverage: 2:294/300 of query aligns to 1:284/294 of 6smyA
6smzC Crystal structure of sla reductase yihu from e. Coli in complex with nadh
37% identity, 98% coverage: 2:294/300 of query aligns to 1:284/295 of 6smzC
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), Q10 (≠ N11), M11 (= M12), F29 (= F30), D30 (= D31), V31 (≠ L32), M63 (= M64), L64 (= L65), V73 (≠ L74), S94 (= S98), T95 (= T99), R122 (≠ G126)
5je8B The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD (see paper)
32% identity, 98% coverage: 1:294/300 of query aligns to 3:288/294 of 5je8B
3ws7A The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
33% identity, 94% coverage: 4:284/300 of query aligns to 16:283/293 of 3ws7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G8), L21 (= L9), G22 (= G10), I23 (≠ N11), M24 (= M12), N43 (≠ D31), R44 (≠ L32), T45 (≠ V33), K48 (≠ A36), M76 (= M64), V77 (≠ L65), S78 (≠ P66), D82 (≠ H70), Q85 (≠ N73), V133 (= V124), F241 (= F242), K242 (≠ M243), H245 (≠ L246), K248 (= K249)
- binding sulfate ion: T134 (≠ S125), G135 (= G126), K183 (= K174)
3w6zA Crystal structure of NADP bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
32% identity, 94% coverage: 4:284/300 of query aligns to 16:286/296 of 3w6zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G8), L21 (= L9), G22 (= G10), I23 (≠ N11), M24 (= M12), N43 (≠ D31), R44 (≠ L32), T45 (≠ V33), K48 (≠ A36), V77 (≠ L65), S78 (≠ P66), D82 (≠ H70), Q85 (≠ N73), V133 (= V124), F244 (= F242), K245 (≠ M243), H248 (≠ L246), K251 (= K249)
2cvzC Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus hb8 (see paper)
31% identity, 94% coverage: 1:281/300 of query aligns to 1:266/289 of 2cvzC
- active site: S117 (= S125), K165 (= K174), N168 (= N177), N169 (= N178)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), L9 (= L9), G10 (= G10), A11 (≠ N11), M12 (= M12), N30 (≠ F30), R31 (≠ D31), T32 (≠ L32), C62 (≠ M64), L63 (= L65), P64 (= P66), E68 (≠ H70), E71 (≠ N73), S91 (≠ T99), V116 (= V124), F227 (= F242), K234 (= K249)
1wp4A Structure of tt368 protein from thermus thermophilus hb8 (see paper)
30% identity, 93% coverage: 2:281/300 of query aligns to 1:265/288 of 1wp4A
- active site: S116 (= S125), K164 (= K174), N167 (= N177), N168 (= N178)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G8), L8 (= L9), G9 (= G10), A10 (≠ N11), M11 (= M12), N29 (≠ F30), R30 (≠ D31), T31 (≠ L32), K34 (≠ T35), C61 (≠ M64), L62 (= L65), P63 (= P66), E67 (≠ H70), S90 (≠ T99), V115 (= V124), T225 (≠ G241), F226 (= F242), K233 (= K249)
- binding sulfate ion: S116 (= S125), G117 (= G126), G118 (= G127), K164 (= K174)
3pefA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with NADP+ (see paper)
30% identity, 97% coverage: 6:295/300 of query aligns to 6:285/287 of 3pefA
- binding glycerol: D67 (≠ A67), G123 (= G126), K171 (= K174), N175 (= N178), M178 (≠ L181), L203 (≠ M209), G207 (≠ S213), N213 (= N223), A217 (≠ G227), F232 (= F242), H236 (≠ L246), K239 (= K249), R242 (≠ G252), R269 (≠ A279)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G10), I11 (≠ N11), M12 (= M12), N31 (≠ D31), R32 (≠ L32), S33 (≠ V33), K36 (≠ A36), M64 (= M64), L65 (= L65), A66 (≠ P66), A70 (≠ H70), E73 (≠ N73), T96 (= T99), V121 (= V124), G123 (= G126), S124 (≠ G127), A231 (≠ G241), F232 (= F242), H236 (≠ L246), K239 (= K249)
3pduA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with NADP+ (see paper)
29% identity, 98% coverage: 1:293/300 of query aligns to 1:283/287 of 3pduA
- binding glycerol: R242 (≠ G252), E246 (= E256), E246 (= E256), R250 (≠ N262)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), G10 (= G10), I11 (≠ N11), M12 (= M12), N31 (≠ D31), R32 (≠ L32), N33 (≠ V33), M64 (= M64), L65 (= L65), A66 (≠ P66), A70 (≠ H70), T96 (= T99), V121 (= V124), G123 (= G126), T124 (≠ G127), K171 (= K174), S231 (≠ G241), F232 (= F242), P233 (≠ M243), H236 (≠ L246), K239 (= K249)
Query Sequence
>200847 FitnessBrowser__MR1:200847
MSTVAFIGLGNMGGPMAANLLKAGMTVRVFDLVHTAMQTLAEQGALVSSTACGAAAGANV
VITMLPAGKHVKNLYLGSGSEKGLLDVVASDTLLIDCSTIDAQSAQLVATQAAKNGLEFM
DAPVSGGTSGAAAGTLTFICGGSDTAFERAQPVLNAMGKNIFHAGGPGAGQIAKICNNML
LSVLMVGTSEALQMGIDHGLDPKVLSNIMKVSSGGNWTLEKYNPCPGVMENVPSSKGYQG
GFMVDLMVKDLGLSFEAALLSNSSTPMGALARSLYVSHARQGNGHRDFSSIFEQFAPLKK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory