Comparing 200933 FitnessBrowser__MR1:200933 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q05683 Glutamate decarboxylase 2; 65 kDa glutamic acid decarboxylase; GAD-65; Glutamate decarboxylase 65 kDa isoform; EC 4.1.1.15 from Rattus norvegicus (Rat) (see 2 papers)
26% identity, 88% coverage: 49:515/533 of query aligns to 146:579/585 of Q05683
Sites not aligning to the query:
Q80WP8 Acidic amino acid decarboxylase GADL1; Aspartate 1-decarboxylase; ADC; Cysteine sulfinic acid decarboxylase; CSADC; Glutamate decarboxylase-like protein 1; EC 4.1.1.11; EC 4.1.1.29 from Mus musculus (Mouse) (see paper)
26% identity, 84% coverage: 65:512/533 of query aligns to 129:542/550 of Q80WP8
Q05329 Glutamate decarboxylase 2; 65 kDa glutamic acid decarboxylase; GAD-65; Glutamate decarboxylase 65 kDa isoform; EC 4.1.1.15 from Homo sapiens (Human) (see 3 papers)
26% identity, 88% coverage: 49:515/533 of query aligns to 146:579/585 of Q05329
Sites not aligning to the query:
3vp6A Structural characterization of glutamic acid decarboxylase; insights into the mechanism of autoinactivation (see paper)
27% identity, 86% coverage: 59:515/533 of query aligns to 66:496/500 of 3vp6A
6enzA Crystal structure of mouse gadl1 (see paper)
26% identity, 84% coverage: 65:512/533 of query aligns to 71:479/487 of 6enzA
4obuA Ruminococcus gnavus tryptophan decarboxylase rumgna_01526 (apo) (see paper)
27% identity, 74% coverage: 44:437/533 of query aligns to 42:397/462 of 4obuA
6zekA Crystal structure of mouse csad (see paper)
26% identity, 82% coverage: 65:503/533 of query aligns to 60:459/476 of 6zekA
A7B1V0 Tryptophan decarboxylase; Trp decarboxylase; EC 4.1.1.105 from Ruminococcus gnavus (strain ATCC 29149 / VPI C7-9) (see paper)
27% identity, 74% coverage: 44:437/533 of query aligns to 57:425/490 of A7B1V0
4obvC Ruminococcus gnavus tryptophan decarboxylase rumgna_01526 (alpha-fmt) (see paper)
27% identity, 74% coverage: 44:437/533 of query aligns to 42:407/471 of 4obvC
Sites not aligning to the query:
2okkA The x-ray crystal structure of the 65kda isoform of glutamic acid decarboxylase (gad65) (see paper)
26% identity, 88% coverage: 49:515/533 of query aligns to 59:478/483 of 2okkA
2okjB The x-ray crystal structure of the 67kda isoform of glutamic acid decarboxylase (gad67) (see paper)
27% identity, 86% coverage: 59:515/533 of query aligns to 66:496/504 of 2okjB
Q99259 Glutamate decarboxylase 1; 67 kDa glutamic acid decarboxylase; GAD-67; Glutamate decarboxylase 67 kDa isoform; EC 4.1.1.15 from Homo sapiens (Human) (see 4 papers)
27% identity, 86% coverage: 59:515/533 of query aligns to 158:588/594 of Q99259
Sites not aligning to the query:
4rlgD The clear crystal structure of pyridoxal-dependent decarboxylase from sphaerobacter thermophilus dsm 20745
28% identity, 84% coverage: 65:510/533 of query aligns to 65:462/470 of 4rlgD
2jisB Human cysteine sulfinic acid decarboxylase (csad) in complex with plp.
27% identity, 70% coverage: 65:437/533 of query aligns to 66:420/487 of 2jisB
4rizC The crystal structure of y333q mutant pyridoxal-dependent decarboxylase from sphaerobacter thermophilus dsm 20745
28% identity, 84% coverage: 65:510/533 of query aligns to 69:467/476 of 4rizC
5o5cB The crystal structure of dfoj, the desferrioxamine biosynthetic pathway lysine decarboxylase from the fire blight disease pathogen erwinia amylovora (see paper)
23% identity, 79% coverage: 22:442/533 of query aligns to 18:415/468 of 5o5cB
J7GQ11 L-tyrosine decarboxylase; TDC; EC 4.1.1.25 from Levilactobacillus brevis (Lactobacillus brevis) (see paper)
25% identity, 68% coverage: 64:425/533 of query aligns to 76:508/626 of J7GQ11
Sites not aligning to the query:
7cx0B Crystal structure of a tyrosine decarboxylase from enterococcus faecalis in complex with the cofactor plp and inhibitor carbidopa
27% identity, 67% coverage: 59:415/533 of query aligns to 66:491/603 of 7cx0B
7cx1A Crystal structure of a tyrosine decarboxylase from enterococcus faecalis in complex with the cofactor plp and inhibitor methyl- tyrosine
28% identity, 67% coverage: 59:415/533 of query aligns to 64:490/602 of 7cx1A
Q8RY79 Phenylacetaldehyde synthase; AtPAAS; 3,4-dihydroxyphenylacetaldehyde synthase; DHPAA synthase; Aromatic L-amino acid decarboxylase; Aromatic aldehyde synthase; AtAAS; EC 4.1.1.109; EC 4.1.1.107 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
24% identity, 85% coverage: 53:504/533 of query aligns to 58:471/490 of Q8RY79
>200933 FitnessBrowser__MR1:200933
MRIFTVPEDADSTLSIIEQKLSEDLAGFLGDSIAALEKPLSEIETDFQTFEIPNQPRFVS
DYTDEIMQNLVAHSVHTAAPSFIGHMTSALPYFVLPLSKMMVGLNQNLVKIETSKAFTPL
ERQVLGMMHHLIYAQHDDFYRNWMHSANHSLGAFCSGGTVANITALWIARNQLLKADGDF
KGVTREGLIKALRHYDYDDLAILVSERGHYSLGKAVDLLGIGRDNIISIPTDADNKVDVT
QMRKIAVELAHKRIKVMAIVGVAGTTETGNIDPLKQLAALASELNCHFHVDAAWGGASLL
SNKYRHLLDGVELADSVTIDAHKQMYVPMGAGMVLFKNPEFAHAIAHHAEYILRRGSKDL
GSQTLEGSRPGMAMLVHACLQIIGRDGYEILINNSLEKARYFAEQIDAHPDFELVTAPEL
CLLTYRYVPASVQAAMQVAIEQGDKAKLERFNEQLDGLTQFIQKHQREQGKSFVSRTRIQ
PARYFRQPTVVFRVVLANPLTSHEILNQVLIEQGEIATLDKEFLPALLAMVAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory