Comparing 200963 FitnessBrowser__MR1:200963 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
33% identity, 95% coverage: 5:253/261 of query aligns to 1:238/240 of 4ymuJ
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
34% identity, 95% coverage: 4:251/261 of query aligns to 2:244/253 of 7z15I
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
34% identity, 95% coverage: 4:251/261 of query aligns to 2:244/250 of 7z18I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
33% identity, 95% coverage: 4:251/261 of query aligns to 2:244/250 of 7z16I
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
30% identity, 95% coverage: 4:252/261 of query aligns to 2:260/330 of P0AAH4
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 95% coverage: 5:252/261 of query aligns to 1:242/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
32% identity, 95% coverage: 5:252/261 of query aligns to 2:243/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
32% identity, 95% coverage: 5:252/261 of query aligns to 2:243/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
32% identity, 95% coverage: 5:252/261 of query aligns to 2:243/344 of 6cvlD
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 95% coverage: 4:252/261 of query aligns to 1:237/241 of 4u00A
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 98% coverage: 3:257/261 of query aligns to 15:254/378 of P69874
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
31% identity, 85% coverage: 28:248/261 of query aligns to 17:235/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
31% identity, 85% coverage: 28:248/261 of query aligns to 17:235/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
31% identity, 85% coverage: 28:248/261 of query aligns to 17:235/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
31% identity, 85% coverage: 28:248/261 of query aligns to 17:235/242 of 2oljA
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
33% identity, 85% coverage: 34:255/261 of query aligns to 46:267/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
33% identity, 85% coverage: 34:255/261 of query aligns to 46:267/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
33% identity, 83% coverage: 33:248/261 of query aligns to 45:260/260 of 7ahdC
Sites not aligning to the query:
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
34% identity, 84% coverage: 33:251/261 of query aligns to 27:255/326 of Q8RDH4
Sites not aligning to the query:
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
34% identity, 84% coverage: 33:251/261 of query aligns to 26:254/310 of 4fwiB
Sites not aligning to the query:
>200963 FitnessBrowser__MR1:200963
MTTPLLKVNDLFKRYDTGYKGFTRQYNDALAPVSFELNRGETLAIVGEAGSGKSTLARIL
VGAEPRSGGEIYFEGEALDSRNIKQRCRLIRMIFQDPNTSLNPRLTIGQLLDEPLRFNTQ
LSAKERNTQVIDTLRKVGLLPEHSDFYPHMISEGQKQRVAVARALMLNPKIIIADEALTA
LDLSVRSQILNLLLKLQKDLGLSYIFVSHNLNIIRHVSDKIMVLHKGVMVEKAPTEQIFN
SPQHEYTQRLVQEQSLFVHKR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory