Comparing 200964 FitnessBrowser__MR1:200964 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
56% identity, 98% coverage: 1:327/335 of query aligns to 1:328/330 of P0AAH4
8j5qD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- translocation state (see paper)
34% identity, 95% coverage: 2:320/335 of query aligns to 2:316/611 of 8j5qD
Sites not aligning to the query:
8j5tD Cryo-em structure of mycobacterium tuberculosis oppabcd in the catalytic intermediate state (see paper)
34% identity, 95% coverage: 2:320/335 of query aligns to 2:316/608 of 8j5tD
Sites not aligning to the query:
8j5sD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- catalytic intermediate state (see paper)
34% identity, 95% coverage: 2:320/335 of query aligns to 2:316/608 of 8j5sD
Sites not aligning to the query:
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
29% identity, 97% coverage: 3:326/335 of query aligns to 4:322/326 of Q8RDH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
29% identity, 96% coverage: 3:322/335 of query aligns to 3:307/310 of 4fwiB
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
33% identity, 78% coverage: 2:261/335 of query aligns to 2:247/250 of 7z18I
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
33% identity, 78% coverage: 2:261/335 of query aligns to 2:247/253 of 7z15I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
32% identity, 78% coverage: 2:261/335 of query aligns to 2:247/250 of 7z16I
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 76% coverage: 3:258/335 of query aligns to 1:241/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
29% identity, 76% coverage: 3:258/335 of query aligns to 2:242/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
29% identity, 76% coverage: 3:258/335 of query aligns to 2:242/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
29% identity, 76% coverage: 3:258/335 of query aligns to 2:242/344 of 3tuiC
3c4jA Abc protein artp in complex with atp-gamma-s
28% identity, 74% coverage: 12:258/335 of query aligns to 8:238/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
28% identity, 74% coverage: 12:258/335 of query aligns to 8:238/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
28% identity, 74% coverage: 12:258/335 of query aligns to 8:238/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
28% identity, 74% coverage: 12:258/335 of query aligns to 8:238/242 of 2oljA
7arlD Lolcde in complex with lipoprotein and adp (see paper)
33% identity, 59% coverage: 22:219/335 of query aligns to 21:204/222 of 7arlD
7mdyC Lolcde nucleotide-bound
33% identity, 59% coverage: 22:219/335 of query aligns to 21:204/226 of 7mdyC
Sites not aligning to the query:
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
31% identity, 62% coverage: 22:230/335 of query aligns to 24:218/233 of P75957
>200964 FitnessBrowser__MR1:200964
MPLLDVRNLTIELDTPHGKVRALEKVSLTLNAGEIHGLVGESGSGRSLLARAILGIPGPN
WTITADRMMWDGNNLMAMSSKERRNLMGSDMAMIFQDPSGSLDPSQTVGSQLMQAMPKNP
KAYFWQKHKHAKLTAQKWLHKVGIKNPQKVMSSYAWELSEGECQKVMIAMAIANQPRLLI
ADEPTNSMELSTQAQIFRLLSQLNQLQNVSILIISHELETLAQWCDHLSVLYCGQVMESG
PTDELINQPYHPYTKALLDNMPDYSGIEAHKAIMPTLPGSAPALQHLPIGCRLGPRCPEA
QKKCVNQPSLSHSRDRYFACHFPYHGETTNDDPTA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory