Comparing 201123 FitnessBrowser__MR1:201123 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1cjxA Crystal structure of pseudomonas fluorescens hppd (see paper)
43% identity, 99% coverage: 6:346/346 of query aligns to 3:351/352 of 1cjxA
7xntA Crystal structure of pfhppd-y13161 complex
43% identity, 97% coverage: 6:340/346 of query aligns to 6:341/341 of 7xntA
7x8eA Crystal structure of pfhppd-y13287 complex
42% identity, 98% coverage: 6:344/346 of query aligns to 5:341/341 of 7x8eA
7xntC Crystal structure of pfhppd-y13161 complex
40% identity, 95% coverage: 6:335/346 of query aligns to 5:320/320 of 7xntC
1t47A Structure of fe2-hppd bound to ntbc (see paper)
35% identity, 80% coverage: 65:342/346 of query aligns to 73:362/362 of 1t47A
7yvvA Acmp1, r-4-hydroxymandelate synthase
29% identity, 84% coverage: 52:340/346 of query aligns to 47:334/335 of 7yvvA
P32755 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; F Alloantigen; F protein; EC 1.13.11.27 from Rattus norvegicus (Rat) (see 2 papers)
30% identity, 86% coverage: 50:346/346 of query aligns to 63:381/393 of P32755
Sites not aligning to the query:
Q02110 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; EC 1.13.11.27 from Sus scrofa (Pig) (see paper)
29% identity, 86% coverage: 50:346/346 of query aligns to 63:381/393 of Q02110
Sites not aligning to the query:
Q88JU3 3-dehydroshikimate dehydratase; DSD; EC 4.2.1.118 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
28% identity, 95% coverage: 12:338/346 of query aligns to 295:624/635 of Q88JU3
Sites not aligning to the query:
5ec3A Structural insight into the catalyitc mechanism of human 4- hydroxyphenylpyruvate dioxygenase
30% identity, 86% coverage: 50:346/346 of query aligns to 55:373/376 of 5ec3A
8im2A Crystal structure of human hppd complexed with ntbc (see paper)
30% identity, 85% coverage: 50:344/346 of query aligns to 57:373/374 of 8im2A
8im3A Crystal structure of human hppd complexed with compound a10 (see paper)
30% identity, 84% coverage: 50:340/346 of query aligns to 57:369/371 of 8im3A
5hmqD Xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein
28% identity, 95% coverage: 12:338/346 of query aligns to 297:621/624 of 5hmqD
Sites not aligning to the query:
O52791 4-hydroxymandelate synthase; HMS; HmaS; 4-hydroxyphenylpyruvate dioxygenase II; EC 1.13.11.46 from Amycolatopsis orientalis (Nocardia orientalis) (see paper)
27% identity, 88% coverage: 33:337/346 of query aligns to 27:343/357 of O52791
2r5vA Hydroxymandelate synthase crystal structure (see paper)
26% identity, 89% coverage: 33:340/346 of query aligns to 26:344/346 of 2r5vA
1sqiA Structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases (see paper)
29% identity, 82% coverage: 50:331/346 of query aligns to 56:343/343 of 1sqiA
1sqiB Structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases (see paper)
29% identity, 82% coverage: 50:331/346 of query aligns to 57:342/342 of 1sqiB
5ywkA Crystal structure of arabidopsis thaliana hppd complexed with benquitrione-methyl (see paper)
33% identity, 79% coverage: 64:337/346 of query aligns to 91:370/372 of 5ywkA
6isdA Crystal structure of arabidopsis thaliana hppd complexed with sulcotrione (see paper)
32% identity, 79% coverage: 64:337/346 of query aligns to 90:367/369 of 6isdA
5xgkA Crystal structure of arabidopsis thaliana 4-hydroxyphenylpyruvate dioxygenase (athppd) complexed with its substrate 4- hydroxyphenylpyruvate acid (hppa) (see paper)
32% identity, 79% coverage: 64:337/346 of query aligns to 91:363/368 of 5xgkA
>201123 FitnessBrowser__MR1:201123
MASELNPLGLLGIEFTEFASSDTDFMHKVFIDFGFSLLKKAKNKDILYYKQNDINFLLNK
QREGFSAKFAKSHGPAICSMGWRVEDASFAHRVAVERGAKAADDSAKDLPYPAIYGIGDS
LIYFIDTFGANNNIYATDFEDLSEPVITQEKGFIEVDHLTNNVYKGTMEHWANFYKNIFG
FTEVRYFDISGVQTALVSYALRSPDGSFCIPINEGKGNDKNQIDEYLKEYNGPGVQHLAF
RSRDIVKSLDAMEGSSIQCLDIIPEYYDTIFDKVPQVTENRDRIKHHQILVDGDESGYLL
QIFTKNLFGPIFIEIIQRKNNLGFGEGNFTALFQSIERDQMRRGVL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory