Comparing 201141 FitnessBrowser__MR1:201141 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6nfeA Crystal structure of ribose-phosphate pyrophosphokinase from legionella pneumophila with bound amp, adp, and ribose-5-phosphate
28% identity, 76% coverage: 69:297/301 of query aligns to 62:284/298 of 6nfeA
Sites not aligning to the query:
Q97Z86 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
25% identity, 71% coverage: 67:281/301 of query aligns to 58:273/291 of Q97Z86
P9WKE3 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
26% identity, 69% coverage: 73:281/301 of query aligns to 75:287/326 of P9WKE3
Sites not aligning to the query:
6nfeB Crystal structure of ribose-phosphate pyrophosphokinase from legionella pneumophila with bound amp, adp, and ribose-5-phosphate
28% identity, 76% coverage: 69:297/301 of query aligns to 62:285/299 of 6nfeB
Sites not aligning to the query:
7xmvA E.Coli phosphoribosylpyrophosphate (prpp) synthetase type a(amp/adp) filament bound with adp, amp and r5p (see paper)
29% identity, 72% coverage: 70:287/301 of query aligns to 62:275/307 of 7xmvA
Sites not aligning to the query:
7xmuA E.Coli phosphoribosylpyrophosphate (prpp) synthetase type a filament bound with adp, pi and r5p (see paper)
29% identity, 72% coverage: 70:287/301 of query aligns to 62:275/307 of 7xmuA
Sites not aligning to the query:
P14193 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PPRibP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Bacillus subtilis (strain 168) (see 4 papers)
29% identity, 71% coverage: 70:282/301 of query aligns to 70:282/317 of P14193
Sites not aligning to the query:
P0A717 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Escherichia coli (strain K12) (see 4 papers)
28% identity, 72% coverage: 70:287/301 of query aligns to 64:283/315 of P0A717
Sites not aligning to the query:
4s2uA Crystal structure of the phosphorybosylpyrophosphate synthetase from e. Coli
28% identity, 72% coverage: 70:287/301 of query aligns to 63:282/308 of 4s2uA
6asvC E. Coli prpp synthetase (see paper)
28% identity, 72% coverage: 70:287/301 of query aligns to 62:281/311 of 6asvC
1dkuA Crystal structures of bacillus subtilis phosphoribosylpyrophosphate synthetase: molecular basis of allosteric inhibition and activation. (see paper)
28% identity, 62% coverage: 70:255/301 of query aligns to 62:237/295 of 1dkuA
Sites not aligning to the query:
1ibsA Phosphoribosyldiphosphate synthetase in complex with cadmium ions (see paper)
28% identity, 71% coverage: 70:282/301 of query aligns to 62:263/297 of 1ibsA
1ibsB Phosphoribosyldiphosphate synthetase in complex with cadmium ions (see paper)
28% identity, 71% coverage: 70:282/301 of query aligns to 64:265/299 of 1ibsB
4twbA Sulfolobus solfataricus ribose-phosphate pyrophosphokinase (see paper)
23% identity, 71% coverage: 67:281/301 of query aligns to 58:260/278 of 4twbA
Sites not aligning to the query:
Q63XL8 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Burkholderia pseudomallei (strain K96243) (see paper)
28% identity, 73% coverage: 70:290/301 of query aligns to 67:286/318 of Q63XL8
3dahC 2.3 a crystal structure of ribose-phosphate pyrophosphokinase from burkholderia pseudomallei (see paper)
29% identity, 73% coverage: 70:290/301 of query aligns to 62:274/300 of 3dahC
Sites not aligning to the query:
7pn0A Crystal structure of the phosphorybosylpyrophosphate synthetase ii from thermus thermophilus at r32 space group
28% identity, 68% coverage: 51:255/301 of query aligns to 55:248/312 of 7pn0A
5t3oA Crystal structure of the phosphorybosylpyrophosphate synthetase ii from thermus thermophilus (see paper)
28% identity, 68% coverage: 51:255/301 of query aligns to 54:247/307 of 5t3oA
Sites not aligning to the query:
3lpnA Crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with an atp analog (ampcpp). (see paper)
25% identity, 74% coverage: 70:292/301 of query aligns to 59:271/284 of 3lpnA
Sites not aligning to the query:
3mbiA Crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with adp-mg2+ and ribose 5- phosphate (see paper)
25% identity, 74% coverage: 70:292/301 of query aligns to 61:273/287 of 3mbiA
Sites not aligning to the query:
>201141 FitnessBrowser__MR1:201141
MSQRIQVSQQIQTSQDVSKAQCLQADFYQLPAASDEANYRLFQFGAGENHVQLLVPPAKR
VTLFFGYRGDHSIMQLLLLTDALRRNGAEQIDLLLPYMPGARQDRVCNVGEALSVKVYAS
LINQQQYASVSVFDPHSDVTAALLDRVQVIDNHSFVAAIAAQLTGELVLVSPDAGANKKV
FGLAKALQGMPVIRADKHRDVVNGHIIATEVFCDDLSGKTCLIVDDICAGGRTFIELAIK
LKQKRAQSVILIVSHYEDKASESALREAGIDRLFCTDSLGVPTHISSEFCDCHAVLSYMN
H
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory