Comparing 201209 FitnessBrowser__MR1:201209 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
24% identity, 87% coverage: 30:404/429 of query aligns to 3:361/363 of 7cyxA
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
27% identity, 49% coverage: 28:238/429 of query aligns to 25:223/824 of Q8GAI3
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
30% identity, 18% coverage: 164:242/429 of query aligns to 127:205/364 of 1ng3A
Sites not aligning to the query:
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
30% identity, 18% coverage: 164:242/429 of query aligns to 127:205/369 of O31616
Sites not aligning to the query:
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
30% identity, 18% coverage: 164:242/429 of query aligns to 127:205/364 of 3if9A
Sites not aligning to the query:
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
26% identity, 59% coverage: 151:402/429 of query aligns to 116:371/377 of Q5L2C2
Sites not aligning to the query:
>201209 FitnessBrowser__MR1:201209
MSAKRCASYYNATIKQESDYPELEGDIHVDVTIIGGGFTGVATAVELSEKGYKVALLEAN
KIAWGATGRNGGQVTGSLSGDAAMTKQLRRHLGQDAEDYVWNLRWRGHDIIKNRVAKYGI
DCDLKFGHIQTAYHPGHMQELQQMFDEANRRGMGEFMTLVPAQEMSAYLASPLYHGGLVN
RRNMHLHSVNLCLGEARAAASLGAQIFEHSQVLDIQQAELATVVTPKGTVKANSVLIAGN
AYHKLGRPKLRGMLFPASLGNCATAKLPEELAKQLNPQNLAVYDCRFVLDYYRLTADNRL
MFGGGTNYSGRDPKNVAAELRPAIERTFPQLKGVDIEFAWAGMAGIVINRIPQLGKISPN
IFYCQGYSGHGVATSHIMAEIMGQAIDGQMQEFDLFAAMRHIRIPLNEWFGNQALALGML
YYTLRENWR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory