Comparing 201229 FitnessBrowser__MR1:201229 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1fg7A Crystal structure of l-histidinol phosphate aminotransferase with pyridoxal-5'-phosphate (see paper)
47% identity, 89% coverage: 43:390/391 of query aligns to 7:353/354 of 1fg7A
1fg3A Crystal structure of l-histidinol phosphate aminotransferase complexed with l-histidinol (see paper)
47% identity, 89% coverage: 43:390/391 of query aligns to 7:353/354 of 1fg3A
7szpA Crystal structure of histidinol-phosphate aminotransferase from klebsiella pneumoniae subsp. Pneumoniae (strain hs11286)
46% identity, 89% coverage: 43:389/391 of query aligns to 7:352/353 of 7szpA
1geyA Crystal structure of histidinol-phosphate aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate (see paper)
47% identity, 81% coverage: 66:383/391 of query aligns to 16:332/335 of 1geyA
3cq6A Histidinol-phosphate aminotransferase from corynebacterium glutamicum holo-form (plp covalently bound ) (see paper)
34% identity, 75% coverage: 65:358/391 of query aligns to 27:331/364 of 3cq6A
Sites not aligning to the query:
3cq5B Histidinol-phosphate aminotransferase from corynebacterium glutamicum in complex with pmp (see paper)
34% identity, 75% coverage: 65:358/391 of query aligns to 29:333/366 of 3cq5B
1uu1A Complex of histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
33% identity, 73% coverage: 53:337/391 of query aligns to 8:280/329 of 1uu1A
Sites not aligning to the query:
1h1cA Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (see paper)
33% identity, 73% coverage: 53:337/391 of query aligns to 8:280/329 of 1h1cA
Q9X0D0 Histidinol-phosphate aminotransferase; Imidazole acetol-phosphate transaminase; EC 2.6.1.9 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
33% identity, 73% coverage: 53:337/391 of query aligns to 13:285/335 of Q9X0D0
1uu0A Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
33% identity, 73% coverage: 53:337/391 of query aligns to 7:279/328 of 1uu0A
2f8jA Crystal structure of histidinol-phosphate aminotransferase (ec 2.6.1.9) (imidazole acetol-phosphate transferase) (tm1040) from thermotoga maritima at 2.40 a resolution
33% identity, 73% coverage: 53:337/391 of query aligns to 14:286/335 of 2f8jA
8bj3A Crystal structure of medicago truncatula histidinol-phosphate aminotransferase (hisn6) in complex with histidinol-phosphate (see paper)
30% identity, 87% coverage: 45:384/391 of query aligns to 5:354/360 of 8bj3A
4r8dA Crystal structure of rv1600 encoded aminotransferase in complex with plp-mes from mycobacterium tuberculosis
34% identity, 69% coverage: 88:358/391 of query aligns to 60:333/369 of 4r8dA
4r5zA Crystal structure of rv3772 encoded aminotransferase (see paper)
28% identity, 62% coverage: 39:279/391 of query aligns to 1:248/353 of 4r5zA
4r2nA Crystal structure of rv3772 in complex with its substrate (see paper)
28% identity, 62% coverage: 39:279/391 of query aligns to 1:248/353 of 4r2nA
Sites not aligning to the query:
3ly1D Crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution
30% identity, 54% coverage: 66:275/391 of query aligns to 19:240/354 of 3ly1D
1lc8A Crystal structure of l-threonine-o-3-phosphate decarboxylase from s. Enterica complexed with its reaction intermediate (see paper)
27% identity, 77% coverage: 84:384/391 of query aligns to 43:345/356 of 1lc8A
Sites not aligning to the query:
1lkcA Crystal structure of l-threonine-o-3-phosphate decarboxylase from salmonella enterica (see paper)
27% identity, 77% coverage: 84:384/391 of query aligns to 42:344/355 of 1lkcA
Sites not aligning to the query:
1lc7A Crystal structure of l-threonine-o-3-phosphate decarboxylase from s. Enterica complexed with a substrate (see paper)
27% identity, 77% coverage: 84:384/391 of query aligns to 46:348/358 of 1lc7A
Sites not aligning to the query:
P97084 Threonine-phosphate decarboxylase; L-threonine-O-3-phosphate decarboxylase; EC 4.1.1.81 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
27% identity, 77% coverage: 84:384/391 of query aligns to 49:351/364 of P97084
Sites not aligning to the query:
>201229 FitnessBrowser__MR1:201229
MSQEPICQEPMSNVTVRSVPSDNSASNPLDKIVIESATLAARLARPELLELTPYQSARRL
GGKGDIWINANESPFNNVAVGELDLTKLNRYPECQPPALINAYSQYSGVVESKIVASRGA
DEAIELLIRAFCIPGIDSIATFGPTYGMYAISAQTFNVGVKALSLSAEYGLPADFATAAR
GAKLVFICNPNNPTGTVIDKARIEQAIQALPDSIVVVDEAYIEFCPEYSVADLLETYPNL
VVLRTLSKAFALAGARCGFLLANEEIIEIIMRVIAPYPVPLPVSEVAEQALSPAGIARMK
TQVKELNTQGERLAAALNLYCEQWGGAVLKPNGNYVLAEFDDVAKVAKLLTDNGIVARAY
KDPRLAKAIRFSFSSQVDTDRLVSLFESQKR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory