Comparing 201272 FitnessBrowser__MR1:201272 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P37595 Isoaspartyl peptidase; Beta-aspartyl-peptidase; EcAIII; Isoaspartyl dipeptidase; EC 3.4.19.5 from Escherichia coli (strain K12) (see 2 papers)
50% identity, 96% coverage: 14:326/326 of query aligns to 6:314/321 of P37595
Q7L266 Isoaspartyl peptidase/L-asparaginase; Asparaginase-like protein 1; Beta-aspartyl-peptidase; Isoaspartyl dipeptidase; L-asparagine amidohydrolase; EC 3.4.19.5; EC 3.5.1.1 from Homo sapiens (Human) (see 4 papers)
38% identity, 94% coverage: 11:316/326 of query aligns to 3:292/308 of Q7L266
4osxA Structure of uncleaved glycine-bound human l-asparaginase protein (see paper)
38% identity, 95% coverage: 6:316/326 of query aligns to 1:284/300 of 4osxA
4pvrA Crystal structure of partially-cleaved human l-asparaginase protein in complex with l-aspartate (see paper)
37% identity, 95% coverage: 6:316/326 of query aligns to 1:282/298 of 4pvrA
4o0hA Crystal structure of human l-asparaginase protein with covalently linked substrate l-asparagine (see paper)
37% identity, 95% coverage: 6:316/326 of query aligns to 1:279/295 of 4o0hA
4o48A Crystal structure of cleaved guinea pig l-asparaginase type iii in complex with l-aspartate (see paper)
37% identity, 93% coverage: 14:316/326 of query aligns to 6:282/298 of 4o48A
1jn9A Structure of putative asparaginase encoded by escherichia coli ybik gene (see paper)
49% identity, 47% coverage: 14:167/326 of query aligns to 5:158/158 of 1jn9A
8c0iAAA Isoaspartyl peptidase subunit alpha (see paper)
50% identity, 47% coverage: 14:165/326 of query aligns to 5:156/156 of 8c0iAAA
2zalB Crystal structure of e. Coli isoaspartyl aminopeptidase/l-asparaginase in complex with l-aspartate (see paper)
56% identity, 41% coverage: 191:325/326 of query aligns to 1:135/135 of 2zalB
Q47898 N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase; Aspartylglucosaminidase; AGA; Glycosylasparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase; EC 3.5.1.26 from Elizabethkingia miricola (Chryseobacterium miricola) (see 5 papers)
38% identity, 76% coverage: 49:296/326 of query aligns to 68:309/340 of Q47898
Sites not aligning to the query:
8c23DDD Isoaspartyl peptidase subunit beta (see paper)
56% identity, 41% coverage: 191:325/326 of query aligns to 1:135/135 of 8c23DDD
1p4vA Crystal structure of the glycosylasparaginase precursor d151n mutant with glycine (see paper)
39% identity, 71% coverage: 49:281/326 of query aligns to 23:240/295 of 1p4vA
4r4yA Structural basis of a point mutation that causes the genetic disease aspartylglucosaminuria (see paper)
39% identity, 71% coverage: 49:281/326 of query aligns to 21:238/293 of 4r4yA
2gezB Crystal structure of potassium-independent plant asparaginase (see paper)
53% identity, 41% coverage: 191:323/326 of query aligns to 1:130/133 of 2gezB
2gezC Crystal structure of potassium-independent plant asparaginase (see paper)
41% identity, 46% coverage: 12:161/326 of query aligns to 3:151/166 of 2gezC
4pu6B Crystal structure of potassium-dependent plant-type l-asparaginase from phaseolus vulgaris in complex with k+ cations (see paper)
48% identity, 41% coverage: 191:323/326 of query aligns to 1:130/131 of 4pu6B
Q9H6P5 Threonine aspartase 1; Taspase-1; EC 3.4.25.- from Homo sapiens (Human) (see 2 papers)
30% identity, 93% coverage: 14:317/326 of query aligns to 44:355/420 of Q9H6P5
4pv2C Crystal structure of potassium-dependent plant-type l-asparaginase from phaseolus vulgaris in complex with k+ and na+ cations (see paper)
40% identity, 43% coverage: 12:152/326 of query aligns to 3:141/158 of 4pv2C
2a8jB Crystal structure of human taspase1 (acivated form) (see paper)
30% identity, 86% coverage: 14:292/326 of query aligns to 4:253/313 of 2a8jB
P20933 N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase; Aspartylglucosaminidase; Glycosylasparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase; EC 3.5.1.26 from Homo sapiens (Human) (see 11 papers)
35% identity, 65% coverage: 40:251/326 of query aligns to 36:266/346 of P20933
Sites not aligning to the query:
>201272 FitnessBrowser__MR1:201272
MSQNTHANEKPFAIAIHGGAGTISKANLTPELRQAYKDKLKEAVDKGSKVLEQGGDSLVA
VQTAINVLENSPLFNAGVGSVYTYDGGHELDASIMDGKTMNAGAVAGVRHIANPIDLALA
VMNKSEHVMLSGAGAEEFALTQGFTLVANSHFDSDARYQQLLDARQKLQAAQKSEQIAGI
EMNDLDYKFGTVGAVALDKNGNLAAGTSTGGMTAKRFGRIGDSPVIGAGTYAENGVCAVS
ATGHGEFFIRYQVAGDICARVKYQQKSILQAADEVINQRLITAGGSGGVIAVDHRGNIAT
PFNTEGMYRASRSNGEPAQVMIWQDQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory