SitesBLAST
Comparing 201343 FitnessBrowser__MR1:201343 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P06721 Cystathionine beta-lyase MetC; CBL; CL; Beta-cystathionase MetC; Cysteine desulfhydrase MetC; CD; Cysteine lyase MetC; Cysteine-S-conjugate beta-lyase MetC; EC 4.4.1.13; EC 4.4.1.28 from Escherichia coli (strain K12) (see 2 papers)
53% identity, 98% coverage: 1:390/399 of query aligns to 1:394/395 of P06721
- K210 (= K209) modified: N6-(pyridoxal phosphate)lysine
1cl1B Cystathionine beta-lyase (cbl) from escherichia coli (see paper)
53% identity, 96% coverage: 6:390/399 of query aligns to 2:391/392 of 1cl1B
2gqnA Cystathionine beta-lyase (cbl) from escherichia coli in complex with n-hydrazinocarbonylmethyl-2-nitro-benzamide (see paper)
53% identity, 96% coverage: 6:390/399 of query aligns to 1:390/391 of 2gqnA
- active site: R54 (= R59), Y107 (= Y112), D181 (= D184), K206 (= K209)
- binding (5-hydroxy-6-methyl-4-((2-(2-(2-nitrobenzamido)acetyl)hydrazinyl)methyl)pyridin-3-yl)methyl dihydrogen phosphate: C81 (≠ S86), G82 (= G87), A83 (= A88), Y107 (= Y112), E108 (= E113), D181 (= D184), A203 (= A206), T205 (= T208), K206 (= K209), M215 (= M218), Y334 (≠ F336), S335 (= S337), W336 (= W338), R368 (= R368)
2fq6A Cystathionine beta-lyase (cbl) from escherichia coli in complex with n-hydrazinocarbonylmethyl-2-trifluoromethyl-benzamide (see paper)
53% identity, 96% coverage: 6:390/399 of query aligns to 1:390/391 of 2fq6A
- active site: R54 (= R59), Y107 (= Y112), D181 (= D184), K206 (= K209)
- binding phosphoric acid mono-(5-hydroxy-6-methyl-4-{[2-(2-trifluoromethyl-benzoylamino)-acetyl]-hydrazonomethyl}-pyridin-3-ylmethyl)ester: C81 (≠ S86), G82 (= G87), A83 (= A88), Y107 (= Y112), P109 (= P114), D181 (= D184), A203 (= A206), T205 (= T208), K206 (= K209), M215 (= M218), Y334 (≠ F336), S335 (= S337), W336 (= W338), R368 (= R368)
1cl2A Cystathionine beta-lyase (cbl) from escherichia coli in complex with aminoethoxyvinylglycine (see paper)
53% identity, 96% coverage: 6:390/399 of query aligns to 1:390/391 of 1cl2A
- active site: R54 (= R59), Y107 (= Y112), D181 (= D184), K206 (= K209)
- binding (2E,3E)-4-(2-aminoethoxy)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)imino]but-3-enoic acid: C81 (≠ S86), G82 (= G87), A83 (= A88), Y107 (= Y112), D181 (= D184), A203 (= A206), T205 (= T208), K206 (= K209), M215 (= M218), Y334 (≠ F336), S335 (= S337), W336 (= W338), R368 (= R368)
8sadA Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp/malonate complex (c2 form)
53% identity, 98% coverage: 1:390/399 of query aligns to 4:397/398 of 8sadA
- binding magnesium ion: A359 (≠ E352), R362 (= R355), A365 (≠ T358)
- binding pyridoxal-5'-phosphate: C88 (≠ S86), G89 (= G87), A90 (= A88), Y114 (= Y112), D188 (= D184), A210 (= A206), T212 (= T208), K213 (= K209), M222 (= M218), W343 (= W338)
4itxA P113s mutant of e. Coli cystathionine beta-lyase metc inhibited by reaction with l-ala-p (see paper)
53% identity, 96% coverage: 6:390/399 of query aligns to 1:390/391 of 4itxA
- active site: R54 (= R59), Y107 (= Y112), D181 (= D184), K206 (= K209)
- binding {1-[(3-hydroxy-methyl-5-phosphonooxy-methyl-pyridin-4-ylmethyl)-amino]-ethyl}-phosphonic acid: C81 (≠ S86), G82 (= G87), A83 (= A88), Y107 (= Y112), D181 (= D184), A203 (= A206), T205 (= T208), K206 (= K209), M215 (= M218), Y334 (≠ F336), S335 (= S337), W336 (= W338), R368 (= R368)
8sabA Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp adduct with alanine (c2 form)
53% identity, 97% coverage: 4:390/399 of query aligns to 1:391/392 of 8sabA
- binding lysine: N9 (≠ S13), R12 (= R16), R13 (≠ D17), K14 (= K18), T17 (= T21), L330 (≠ H331), E341 (= E342)
- binding pyridoxal-5'-phosphate: C82 (≠ S86), G83 (= G87), A84 (= A88), Y108 (= Y112), D182 (= D184), A204 (= A206), T206 (= T208), K207 (= K209), M216 (= M218), W337 (= W338)
- binding alanyl-pyridoxal-5'-phosphate: C82 (≠ S86), G83 (= G87), A84 (= A88), Y108 (= Y112), D182 (= D184), A204 (= A206), T206 (= T208), K207 (= K209), M216 (= M218), Y335 (≠ F336), S336 (= S337), W337 (= W338), R369 (= R368)
8u99A Crystal structure of cystathionine beta lyase from klebsiella aerogenes (plp-serine adduct)
53% identity, 96% coverage: 6:390/399 of query aligns to 1:390/391 of 8u99A
- binding pyridoxal-5'-phosphate: C81 (≠ S86), G82 (= G87), A83 (= A88), Y107 (= Y112), D181 (= D184), T205 (= T208), K206 (= K209), M215 (= M218), W336 (= W338)
- binding serine: Y107 (= Y112), K206 (= K209), Y334 (≠ F336), S335 (= S337), W336 (= W338), R368 (= R368)
8u98A Crystal structure of cystathionine beta lyase from klebsiella aerogenes (plp-glycine adduct)
53% identity, 96% coverage: 6:390/399 of query aligns to 1:390/391 of 8u98A
- binding glycine: Y107 (= Y112), K206 (= K209), Y334 (≠ F336), S335 (= S337), W336 (= W338), R368 (= R368)
- binding pyridoxal-5'-phosphate: Y52 (= Y57), R54 (= R59), C81 (≠ S86), G82 (= G87), A83 (= A88), Y107 (= Y112), D181 (= D184), A203 (= A206), T205 (= T208), K206 (= K209), M215 (= M218), W336 (= W338)
8sa9A Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp-oxamate adduct (c2 form)
53% identity, 96% coverage: 6:390/399 of query aligns to 1:390/391 of 8sa9A
- binding pyridoxal-5'-phosphate: C81 (≠ S86), G82 (= G87), A83 (= A88), Y107 (= Y112), D181 (= D184), A203 (= A206), T205 (= T208), K206 (= K209), M215 (= M218), W336 (= W338)
- binding [({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino](oxo)acetic acid: C81 (≠ S86), G82 (= G87), A83 (= A88), Y107 (= Y112), D181 (= D184), A203 (= A206), T205 (= T208), K206 (= K209), M215 (= M218), S335 (= S337), W336 (= W338), R368 (= R368)
4l0oH Structure determination of cystathionine gamma-synthase from helicobacter pylori
35% identity, 96% coverage: 6:390/399 of query aligns to 2:373/373 of 4l0oH
- active site: R40 (= R59), Y92 (= Y112), D164 (= D184), K189 (= K209)
- binding pyridoxal-5'-phosphate: Y38 (= Y57), R40 (= R59), S67 (= S86), G68 (= G87), L69 (≠ A88), Y92 (= Y112), D164 (= D184), S186 (≠ A206), T188 (= T208), K189 (= K209)
4omaA The crystal structure of methionine gamma-lyase from citrobacter freundii in complex with l-cycloserine pyridoxal-5'-phosphate (see paper)
34% identity, 94% coverage: 9:383/399 of query aligns to 10:388/396 of 4omaA
- active site: R59 (= R59), Y112 (= Y112), D184 (= D184), K209 (= K209)
- binding [5-hydroxy-6-methyl-4-({[(4E)-3-oxo-1,2-oxazolidin-4-ylidene]amino}methyl)pyridin-3-yl]methyl dihydrogen phosphate: G87 (= G87), I88 (≠ A88), Y112 (= Y112), D184 (= D184), S206 (≠ A206), T208 (= T208), K209 (= K209), V337 (≠ F336), S338 (= S337), R373 (= R368)
3jwbA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with norleucine (see paper)
34% identity, 94% coverage: 9:383/399 of query aligns to 10:388/396 of 3jwbA
3jwaA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with methionine phosphinate (see paper)
34% identity, 94% coverage: 9:383/399 of query aligns to 10:388/396 of 3jwaA
3jw9A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with s-ethyl-cysteine (see paper)
34% identity, 94% coverage: 9:383/399 of query aligns to 10:388/396 of 3jw9A
6egrA Crystal structure of citrobacter freundii methionine gamma-lyase with v358y replacement (see paper)
34% identity, 94% coverage: 9:383/399 of query aligns to 10:388/396 of 6egrA
5m3zA Crystal structure of citrobacter freundii methionine gamma-lyase with c115h replacement in the complex with l-norleucine (see paper)
34% identity, 94% coverage: 9:383/399 of query aligns to 9:387/395 of 5m3zA
- active site: R58 (= R59), Y111 (= Y112), D183 (= D184), K208 (= K209)
- binding norleucine: Y111 (= Y112), H113 (≠ P114), K208 (= K209), V336 (≠ F336), S337 (= S337)
- binding pyridoxal-5'-phosphate: G86 (= G87), I87 (≠ A88), Y111 (= Y112), E154 (= E155), D183 (= D184), T185 (= T186), S205 (≠ A206), T207 (= T208), K208 (= K209)
- binding 2-[o-phosphonopyridoxyl]-amino-hexanoic acid: G86 (= G87), I87 (≠ A88), Y111 (= Y112), D183 (= D184), S205 (≠ A206), T207 (= T208), K208 (= K209), V336 (≠ F336), S337 (= S337), R372 (= R368)
4hf8A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with glycine (see paper)
34% identity, 94% coverage: 9:383/399 of query aligns to 10:388/396 of 4hf8A
- active site: R59 (= R59), Y112 (= Y112), D184 (= D184), K209 (= K209)
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: G87 (= G87), I88 (≠ A88), Y112 (= Y112), E155 (= E155), N159 (≠ S159), D184 (= D184), S206 (≠ A206), K209 (= K209), S338 (= S337), R373 (= R368)
1e5eA Methionine gamma-lyase (mgl) from trichomonas vaginalis in complex with propargylglycine
33% identity, 92% coverage: 23:388/399 of query aligns to 20:390/394 of 1e5eA
- active site: R55 (= R59), Y108 (= Y112), D181 (= D184), K206 (= K209)
- binding n-(hydroxy{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)norvaline: Y53 (= Y57), R55 (= R59), G83 (= G87), M84 (≠ A88), Y108 (= Y112), N155 (≠ S159), D181 (= D184), S203 (≠ A206), T205 (= T208), K206 (= K209), S335 (= S337), T350 (vs. gap), R370 (= R368)
Query Sequence
>201343 FitnessBrowser__MR1:201343
MTDKHQLATQIVSVGRDKKWTKGVINPPVFRASTIVFDTMEDMRHAAKNKTNGEMFYGRR
GTPTHFAFQAAVSELEGGAGTALYPSGAAAISAALLSFLQAGDHLLMVDSVYEPTRDFCS
HILAGFNIETTYYDPLIGEGIRALIRPNTKVLFLESPGSITMEVQDVPTLCRIAHEHGLV
TILDNTWASPINSKPFEMGVDVSIQAATKYIVGHSDVMIGTATANEQYWPQLRERSYLLG
QTTSPDDVYLATRGLRTLGVRMAQHEKNALKVANWLQTRPEVDHLRHPAFETCPGHEFFK
RDFSASNGLFSFVLKQGDQEAVTALVENMQHFKMGFSWGGYESLILGIFGIERIRSATKW
DASKPLIRVHIGLEDPEDLIADLSAGFERFNAVLAAKVK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory