SitesBLAST
Comparing 201352 FitnessBrowser__MR1:201352 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
7qyrD Crystal structure of rimk from pseudomonas aeruginosa pao1 (see paper)
36% identity, 90% coverage: 16:311/330 of query aligns to 10:293/293 of 7qyrD
- binding adenosine-5'-diphosphate: V139 (= V145), Y179 (≠ F187), I180 (= I188), D187 (= D195), R211 (≠ K219), S212 (≠ A220), L250 (= L258), M259 (≠ C267)
- binding : L12 (≠ W18), S14 (≠ E20), R64 (= R71), R189 (= R197), N262 (= N270), S264 (= S272), G266 (= G274)
Sites not aligning to the query:
5zctH The crystal structure of the poly-alpha-l-glutamate peptides synthetase rimk at 2.05 angstrom resolution. (see paper)
35% identity, 84% coverage: 19:294/330 of query aligns to 13:286/292 of 5zctH
- binding phosphoaminophosphonic acid-adenylate ester: V139 (= V145), K141 (= K147), Q177 (= Q185), Y179 (≠ F187), I180 (= I188), D187 (= D195), F210 (= F218), R211 (≠ K219), S212 (≠ A220), N213 (= N221), R216 (≠ A224), L250 (= L258), M259 (≠ C267), E260 (= E268)
- binding magnesium ion: D248 (= D256), E260 (= E268)
5zctA The crystal structure of the poly-alpha-l-glutamate peptides synthetase rimk at 2.05 angstrom resolution. (see paper)
35% identity, 84% coverage: 19:294/330 of query aligns to 13:286/292 of 5zctA
- binding phosphoaminophosphonic acid-adenylate ester: K100 (= K107), K141 (= K147), T146 (≠ S152), Q147 (= Q153), G148 (= G154), Q177 (= Q185), Y179 (≠ F187), I180 (= I188), R211 (≠ K219), S212 (≠ A220), N213 (= N221), L250 (= L258), M259 (≠ C267)
4iwxA Rimk structure at 2.85a (see paper)
35% identity, 84% coverage: 19:294/330 of query aligns to 15:288/294 of 4iwxA
- binding adenosine-5'-diphosphate: V141 (= V145), K143 (= K147), E180 (= E186), Y181 (≠ F187), I182 (= I188), K183 (≠ A189), D189 (= D195), R213 (≠ K219), S214 (≠ A220), N215 (= N221), M261 (≠ C267), E262 (= E268)
- binding glutamic acid: R98 (≠ I103), R104 (≠ F109), Q107 (= Q112), L108 (= L113), R111 (≠ E116)
3vpbB Argx from sulfolobus tokodaii complexed with lysw/glu/adp/mg/zn/sulfate (see paper)
27% identity, 67% coverage: 76:295/330 of query aligns to 56:277/282 of 3vpbB
- binding adenosine-5'-diphosphate: K87 (= K107), I125 (≠ V145), K127 (= K147), S132 (= S152), G134 (= G154), V137 (= V157), Q167 (= Q185), Y169 (≠ F187), I170 (= I188), D176 (= D195), R200 (≠ K219), A201 (= A220), N202 (= N221), N249 (≠ C267), E250 (= E268)
- binding glutamic acid: Y190 (= Y209), R192 (= R211), N202 (= N221), V203 (= V222), A204 (≠ S223), E256 (≠ G274), G259 (= G277)
- binding magnesium ion: D237 (= D256), E250 (= E268)
- binding zinc ion: E250 (= E268), N252 (= N270)
Q970U6 Glutamate--LysW ligase ArgX; EC 6.3.2.- from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see paper)
27% identity, 67% coverage: 76:295/330 of query aligns to 56:277/282 of Q970U6
- D237 (= D256) binding
- E250 (= E268) binding ; binding
- N252 (= N270) binding
Q4JAP9 Alpha-aminoadipate--LysW ligase LysX; AAA--LysW ligase LysX; EC 6.3.2.43 from Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) (see paper)
31% identity, 70% coverage: 66:295/330 of query aligns to 43:271/276 of Q4JAP9
- NT 253:254 (≠ GL 277:278) mutation to GF: Alters substrate specificity, so that glutamate is preferred over alpha-aminoadipate.
3vpdA Lysx from thermus thermophilus complexed with amp-pnp (see paper)
29% identity, 65% coverage: 81:293/330 of query aligns to 63:274/281 of 3vpdA
- binding phosphoaminophosphonic acid-adenylate ester: V127 (= V145), K129 (= K147), W135 (≠ Q153), G136 (= G154), L139 (≠ V157), Q169 (= Q185), V172 (≠ I188), K174 (≠ S191), D178 (= D195), R194 (≠ E210), W199 (≠ F218), T201 (≠ A220), F239 (≠ L258), E249 (= E268)
- binding butanoic acid: F256 (= F275), K257 (≠ E276), N258 (≠ G277), S259 (≠ L278)
5k2mI Bifunctional lysx/argx from thermococcus kodakarensis with lysw-gamma- aaa (see paper)
27% identity, 65% coverage: 80:293/330 of query aligns to 56:266/273 of 5k2mI
- binding adenosine-5'-diphosphate: K83 (= K107), V120 (= V145), K122 (= K147), S127 (= S152), L132 (≠ S160), Q162 (= Q185), V165 (≠ I188), K167 (≠ N190), D171 (= D195), W192 (≠ F218), I193 (≠ K219), T194 (≠ A220), N195 (= N221), F231 (≠ L258), N240 (≠ C267), E241 (= E268)
- binding 2-aminohexanedioic acid: R173 (= R197), N195 (= N221), T196 (≠ V222), A197 (≠ S223), E247 (≠ G274), F248 (= F275), N250 (≠ G277)
- binding : F125 (≠ S150), W128 (≠ Q153), R130 (≠ S155), N153 (= N181), Y156 (vs. gap), N245 (≠ S272)
Sites not aligning to the query:
5k2mG Bifunctional lysx/argx from thermococcus kodakarensis with lysw-gamma- aaa (see paper)
27% identity, 65% coverage: 80:293/330 of query aligns to 56:266/273 of 5k2mG
- binding adenosine-5'-diphosphate: K83 (= K107), V120 (= V145), K122 (= K147), S127 (= S152), G129 (= G154), Q162 (= Q185), V165 (≠ I188), K167 (≠ N190), D171 (= D195), W192 (≠ F218), T194 (≠ A220), N195 (= N221), F231 (≠ L258), N240 (≠ C267), E241 (= E268)
- binding magnesium ion: D229 (= D256), E241 (= E268)
- binding : F125 (≠ S150), S127 (= S152), W128 (≠ Q153), R130 (≠ S155), Y156 (vs. gap), R173 (= R197), R187 (= R211), T196 (≠ V222), A197 (≠ S223), N243 (= N270), P244 (≠ S271), N245 (≠ S272), E247 (≠ G274), F248 (= F275), N250 (≠ G277), A251 (≠ L278)
Sites not aligning to the query:
1uc9A Crystal structure of a lysine biosynthesis enzyme, lysx, from thermus thermophilus hb8 (see paper)
24% identity, 72% coverage: 55:293/330 of query aligns to 37:250/256 of 1uc9A
7waeB Trichodesmium erythraeum cyanophycin synthetase 1 (tecpha1) with atpgammas, 4x(beta-asp-arg), and aspartate (see paper)
26% identity, 34% coverage: 100:211/330 of query aligns to 213:323/877 of 7waeB
Sites not aligning to the query:
- binding phosphothiophosphoric acid-adenylate ester: 450, 497, 498, 499, 500, 558, 692, 696, 731, 745, 746, 748, 752, 755
- binding magnesium ion: 431, 450, 500, 522, 558
- binding : 166, 454, 455, 456
7waeD Trichodesmium erythraeum cyanophycin synthetase 1 (tecpha1) with atpgammas, 4x(beta-asp-arg), and aspartate (see paper)
26% identity, 34% coverage: 100:211/330 of query aligns to 213:323/724 of 7waeD
- binding phosphothiophosphoric acid-adenylate ester: K220 (= K107), V259 (= V145), K261 (= K147), G265 (= G151), N266 (≠ S152), H267 (≠ Q153), G268 (= G154), I271 (≠ V157), I273 (≠ L159), E300 (≠ Q185), Y303 (≠ I188), D307 (= D195)
- binding arginine: N266 (≠ S152)
- binding magnesium ion: N266 (≠ S152)
- binding : R309 (= R197)
Sites not aligning to the query:
- binding phosphothiophosphoric acid-adenylate ester: 450, 497, 498, 499, 500, 501, 558, 692, 696
- binding arginine: 164, 165, 453
- binding aspartic acid: 394, 458
- binding magnesium ion: 431, 450, 450, 452, 500, 522
- binding : 455, 456
7lg5A Synechocystis sp. Utex2470 cyanophycin synthetase 1 with atp (see paper)
23% identity, 53% coverage: 100:275/330 of query aligns to 213:453/871 of 7lg5A
Sites not aligning to the query:
7txuA Cyanophycin synthetase 1 from synechocystis sp. Utex2470 with atp and 16x(asp-arg)
23% identity, 53% coverage: 100:275/330 of query aligns to 213:454/869 of 7txuA
Sites not aligning to the query:
- binding adenosine-5'-triphosphate: 494, 495, 496, 497, 519, 689, 693, 742, 749
- binding magnesium ion: 497, 519, 555
- binding zinc ion: 59, 79, 83
- binding : 14, 16, 17, 18, 19, 57, 58, 86, 87, 90, 96, 97, 99, 100, 164, 165, 166, 202, 203, 597, 604
7lgjA Cyanophycin synthetase 1 from synechocystis sp. Utex2470 with adpcp and 8x(asp-arg)-nh2 (see paper)
23% identity, 53% coverage: 100:275/330 of query aligns to 213:454/869 of 7lgjA
Sites not aligning to the query:
- binding phosphomethylphosphonic acid adenylate ester: 494, 495, 496, 497, 498, 693, 728, 742
- binding magnesium ion: 497, 519, 555
- binding : 164, 165, 166, 187, 202, 203
7lgmA Cyanophycin synthetase from a. Baylyi dsm587 with atp (see paper)
31% identity, 34% coverage: 100:211/330 of query aligns to 211:318/719 of 7lgmA
Sites not aligning to the query:
7drpA Structure of atp-grasp ligase psnb complexed with phosphomimetic variant of minimal precursor, mg, and adp (see paper)
24% identity, 62% coverage: 82:287/330 of query aligns to 107:299/312 of 7drpA
- binding adenosine-5'-diphosphate: K170 (≠ I146), T178 (≠ G154), Q202 (= Q185), E203 (= E186), L205 (≠ I188), D209 (= D195), K269 (≠ L258), L279 (≠ C267), E280 (= E268)
- binding magnesium ion: D267 (= D256), E280 (= E268), E280 (= E268), N282 (= N270)
- binding : Y169 (≠ V145), G175 (= G151), A176 (≠ S152), R179 (≠ S155), R190 (≠ D168), R193 (≠ Q171), L194 (= L172), V199 (≠ I182), R211 (= R197), N282 (= N270), S284 (= S272), A285 (≠ P273), M286 (≠ G274)
Sites not aligning to the query:
7drnA Structure of atp-grasp ligase psnb complexed with precursor peptide psna2 and amppnp (see paper)
24% identity, 62% coverage: 82:287/330 of query aligns to 107:299/311 of 7drnA
- binding phosphoaminophosphonic acid-adenylate ester: K170 (≠ I146), T178 (≠ G154), Q202 (= Q185), E203 (= E186), L205 (≠ I188), D209 (= D195), K269 (≠ L258), L279 (≠ C267), E280 (= E268)
- binding : Y169 (≠ V145), P171 (≠ K147), G175 (= G151), A176 (≠ S152), R179 (≠ S155), R190 (≠ D168), R211 (= R197), S284 (= S272), M286 (≠ G274)
Sites not aligning to the query:
Query Sequence
>201352 FitnessBrowser__MR1:201352
MRGWILYKETATQLKPEWYEIERLLAAAKADNIELEVYAPDEFDLTVTREDNKSILLNGQ
PVELPDFIIPRMGSGTTYFALAIIRHLERLGVYCLNPSKAIEIVKDKLFSQQLLAEKNLP
TPKTMLVKFPVDIDLVERHLGFPVVIKTLSGSQGSGVFLSHKAREFDDLMQLIEATNKNA
NIILQEFIANSHGRDLRVFTIGGRVAGCYERRGQEDSFKANVSAGGSARPFDITPEIEWL
ATQTANILDLDVAGIDLLFDNGHYKICEANSSPGFEGLESCLNVDIAAQILHFIRIRLGM
FNKDEKNSDPQLTHAGPALANNVTSSKAAE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory