SitesBLAST
Comparing 201365 FitnessBrowser__MR1:201365 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wy2A Crystal structure of alpha-glucosidase in complex with glucose (see paper)
56% identity, 99% coverage: 4:540/540 of query aligns to 2:535/535 of 3wy2A
- active site: D97 (= D99), R197 (= R199), D199 (= D201), E268 (= E270), H329 (= H331), D330 (= D332)
- binding beta-D-glucopyranose: D59 (= D61), Y62 (= Y64), H102 (= H104), R197 (= R199), D199 (= D201), E268 (= E270), H329 (= H331), D330 (= D332), R397 (= R399)
- binding glycerol: S101 (= S103), D169 (= D171), V170 (≠ I172), P175 (= P177), R178 (= R180), Q179 (= Q181), F203 (= F205), Y204 (≠ C206), H206 (= H208), D240 (≠ N242), P244 (= P246), E280 (≠ A282)
- binding magnesium ion: D20 (= D22), R22 (≠ N24), V26 (= V28), D28 (= D30)
3wy1A Crystal structure of alpha-glucosidase (see paper)
56% identity, 99% coverage: 4:540/540 of query aligns to 2:535/535 of 3wy1A
- active site: D97 (= D99), R197 (= R199), D199 (= D201), E268 (= E270), H329 (= H331), D330 (= D332)
- binding glycerol: S101 (= S103), D169 (= D171), V170 (≠ I172), F203 (= F205), Y204 (≠ C206), H206 (= H208)
- binding magnesium ion: D20 (= D22), D24 (= D26), V26 (= V28), D28 (= D30)
- binding (3R,5R,7R)-octane-1,3,5,7-tetracarboxylic acid: D59 (= D61), Y62 (= Y64), H102 (= H104), F144 (= F146), F163 (= F165), R197 (= R199), D199 (= D201), T200 (≠ A202), G225 (= G227), E268 (= E270), F294 (= F296), H329 (= H331), D330 (= D332), R397 (= R399)
3wy4A Crystal structure of alpha-glucosidase mutant e271q in complex with maltose (see paper)
56% identity, 99% coverage: 4:540/540 of query aligns to 2:535/535 of 3wy4A
- active site: D97 (= D99), R197 (= R199), D199 (= D201), Q268 (≠ E270), H329 (= H331), D330 (= D332)
- binding alpha-D-glucopyranose: D59 (= D61), Y62 (= Y64), H102 (= H104), I143 (= I145), F163 (= F165), D199 (= D201), T200 (≠ A202), G225 (= G227), Q268 (≠ E270), Q268 (≠ E270), F294 (= F296), H329 (= H331), D330 (= D332), R397 (= R399), R397 (= R399)
- binding glycerol: S101 (= S103), D169 (= D171), V170 (≠ I172), F203 (= F205), Y204 (≠ C206), H206 (= H208), L224 (≠ R226), G225 (= G227), A226 (≠ F228), P227 (≠ S229), F294 (= F296), D330 (= D332), E374 (= E376), K395 (= K397), G396 (= G398), G399 (= G401)
- binding magnesium ion: D20 (= D22), D24 (= D26), V26 (= V28), D28 (= D30)
3wy4B Crystal structure of alpha-glucosidase mutant e271q in complex with maltose (see paper)
55% identity, 68% coverage: 3:371/540 of query aligns to 1:323/421 of 3wy4B
- active site: D75 (= D99), R175 (= R199), D177 (= D201), Q237 (≠ E270)
- binding glycerol: S79 (= S103), N140 (= N164), D147 (= D171), F181 (= F205), Y182 (≠ C206), F183 (= F207), H184 (= H208), D209 (≠ N242)
2ze0A Alpha-glucosidase gsj (see paper)
39% identity, 94% coverage: 5:509/540 of query aligns to 3:497/531 of 2ze0A
O06994 Oligo-1,6-glucosidase 1; Dextrin 6-alpha-D-glucanohydrolase; Oligosaccharide alpha-1,6-glucosidase 1; Sucrase-isomaltase 1; Isomaltase 1; EC 3.2.1.10 from Bacillus subtilis (strain 168) (see paper)
35% identity, 91% coverage: 1:494/540 of query aligns to 1:513/561 of O06994
- D20 (= D22) binding
- N22 (= N24) binding
- D24 (= D26) binding
- F26 (≠ V28) binding
- D28 (= D30) binding
4mazA The structure of mall mutant enzyme v200s from bacillus subtilus (see paper)
35% identity, 91% coverage: 6:494/540 of query aligns to 2:511/559 of 4mazA
7lv6B The structure of mall mutant enzyme s536r from bacillus subtilis
35% identity, 91% coverage: 6:494/540 of query aligns to 2:511/559 of 7lv6B
4m56A The structure of wild-type mall from bacillus subtilis (see paper)
35% identity, 91% coverage: 6:494/540 of query aligns to 2:508/555 of 4m56A
- active site: D95 (= D99), R195 (= R199), D197 (= D201), E250 (= E270), H326 (= H331), D327 (= D332)
- binding D-glucose: D57 (= D61), Y60 (= Y64), H100 (= H104), F142 (= F146), D197 (= D201), E250 (= E270), D327 (= D332), R413 (= R399)
5wczA Crystal structure of wild-type mall from bacillus subtilis with ts analogue 1-deoxynojirimycin (see paper)
35% identity, 91% coverage: 6:494/540 of query aligns to 2:508/556 of 5wczA
- active site: D95 (= D99), R195 (= R199), D197 (= D201), E250 (= E270), H326 (= H331), D327 (= D332)
- binding 1-deoxynojirimycin: D57 (= D61), Y60 (= Y64), H100 (= H104), F161 (= F165), D197 (= D201), V198 (≠ A202), E250 (= E270), H326 (= H331), D327 (= D332), R413 (= R399)
8ibkA Crystal structure of bacillus sp. Ahu2216 gh13_31 alpha-glucosidase e256q/n258g in complex with maltotriose (see paper)
34% identity, 90% coverage: 6:491/540 of query aligns to 3:498/546 of 8ibkA
- binding calcium ion: D19 (= D22), N21 (= N24), D23 (= D26), I25 (≠ V28), D27 (= D30)
- binding alpha-D-glucopyranose: D58 (= D61), Y61 (= Y64), H101 (= H104), I141 (= I145), F161 (= F165), D197 (= D201), A198 (= A202), H201 (= H208), M227 (≠ Y240), Q254 (≠ E270), Q254 (≠ E270), F280 (= F296), H320 (= H331), D321 (= D332), R405 (= R399)
Sites not aligning to the query:
5brpA Crystal structure of bacillus licheniformis trehalose-6-phosphate hydrolase (trea), mutant r201q, in complex with png (see paper)
35% identity, 92% coverage: 6:503/540 of query aligns to 3:513/555 of 5brpA
- active site: D96 (= D99), Q196 (≠ R199), D198 (= D201), E249 (= E270), H323 (= H331), D324 (= D332)
- binding magnesium ion: D19 (= D22), T21 (≠ N24), N23 (≠ D26), V25 (= V28), D27 (= D30)
- binding 4-nitrophenyl alpha-D-glucopyranoside: D58 (= D61), N59 (≠ F62), Y61 (= Y64), H101 (= H104), Y162 (≠ F165), D198 (= D201), V199 (≠ A202), E249 (= E270)
4howA The crystal structure of isomaltulose synthase from erwinia rhapontici nx5 (see paper)
34% identity, 96% coverage: 5:525/540 of query aligns to 5:542/559 of 4howA
4hphA The crystal structure of isomaltulose synthase mutant e295q from erwinia rhapontici nx5 in complex with its natural substrate sucrose (see paper)
34% identity, 96% coverage: 5:525/540 of query aligns to 5:542/559 of 4hphA
- active site: D99 (= D99), R198 (= R199), D200 (= D201), Q254 (≠ E270), H327 (= H331), D328 (= D332)
- binding calcium ion: D22 (= D22), N24 (= N24), D26 (= D26), I28 (≠ V28), D30 (= D30)
- binding beta-D-fructofuranose: F164 (= F165), Q254 (≠ E270), F256 (≠ S272), D328 (= D332), E387 (≠ F388), R415 (= R399)
- binding alpha-D-glucopyranose: D61 (= D61), Y64 (= Y64), H104 (= H104), F164 (= F165), D200 (= D201), Q254 (≠ E270), H327 (= H331), D328 (= D332), R415 (= R399)
6k5pC Structure of mosquito-larvicidal binary toxin receptor, cqm1 (see paper)
35% identity, 92% coverage: 6:503/540 of query aligns to 4:485/531 of 6k5pC
- active site: D97 (= D99), R196 (= R199), D198 (= D201), E264 (≠ S272), H331 (= H331), D332 (= D332)
- binding calcium ion: N101 (≠ S103), D168 (= D171), H202 (≠ F205), M203 (≠ C206), E205 (≠ H208)
- binding cobalt (ii) ion: H429 (= H447), H433 (≠ Q451)
6k5pB Structure of mosquito-larvicidal binary toxin receptor, cqm1 (see paper)
35% identity, 92% coverage: 6:503/540 of query aligns to 4:485/531 of 6k5pB
- active site: D97 (= D99), R196 (= R199), D198 (= D201), E264 (≠ S272), H331 (= H331), D332 (= D332)
- binding calcium ion: N101 (≠ S103), D168 (= D171), H202 (≠ F205), M203 (≠ C206), E205 (≠ H208)
- binding magnesium ion: H7 (≠ G9), A8 (= A10)
6k5pA Structure of mosquito-larvicidal binary toxin receptor, cqm1 (see paper)
35% identity, 92% coverage: 6:503/540 of query aligns to 4:485/531 of 6k5pA
4hozA The crystal structure of isomaltulose synthase mutant d241a from erwinia rhapontici nx5 in complex with d-glucose (see paper)
34% identity, 96% coverage: 5:525/540 of query aligns to 5:542/559 of 4hozA
- active site: D99 (= D99), R198 (= R199), A200 (≠ I203), E254 (= E270), H327 (= H331), D328 (= D332)
- binding calcium ion: D22 (= D22), N24 (= N24), D26 (= D26), I28 (≠ V28), D30 (= D30)
- binding alpha-D-glucopyranose: D61 (= D61), Y64 (= Y64), H104 (= H104), F164 (= F165), R198 (= R199), A200 (≠ I203), E254 (= E270), H327 (= H331), D328 (= D332), R415 (= R399)
3gbeA Crystal structure of the isomaltulose synthase smua from protaminobacter rubrum in complex with the inhibitor deoxynojirimycin (see paper)
33% identity, 97% coverage: 6:528/540 of query aligns to 5:544/558 of 3gbeA
- active site: D98 (= D99), R197 (= R199), D199 (= D201), E253 (= E270), H326 (= H331), D327 (= D332)
- binding 1-deoxynojirimycin: D60 (= D61), Y63 (= Y64), H103 (= H104), F163 (= F165), R197 (= R199), D199 (= D201), H326 (= H331), D327 (= D332), R414 (= R399)
7p01A Structure of the maltase baag2 from blastobotrys adeninivorans in complex with acarbose (see paper)
32% identity, 97% coverage: 6:527/540 of query aligns to 7:561/572 of 7p01A
- binding 4,6-dideoxy-4-{[(1S,4R,5S,6S)-4,5,6-trihydroxy-3-(hydroxymethyl)cyclohex-2-en-1-yl]amino}-alpha-D-glucopyranose: D62 (= D61), Y65 (= Y64), H105 (= H104), Y150 (≠ I145), F170 (= F165), D207 (= D201), T208 (≠ A202), E265 (= E270), F291 (= F296), H338 (= H331), D339 (= D332), R431 (= R399), T529 (≠ L495), D530 (= D496)
- binding calcium ion: D23 (= D22), N25 (= N24), D27 (= D26), I29 (≠ V28), D31 (= D30)
- binding alpha-D-glucopyranose: R224 (≠ K218), F291 (= F296), A295 (vs. gap), E300 (vs. gap), S349 (≠ R342), D350 (≠ G343), D350 (≠ G343), A351 (vs. gap), Q427 (vs. gap), K428 (vs. gap)
- binding 1-methylpyrrolidin-2-one: S19 (≠ R18), I29 (≠ V28), M63 (≠ F62), H74 (≠ D73), W454 (= W423)
Query Sequence
>201365 FitnessBrowser__MR1:201365
MSELTWWRGAVIYQIYPRSLLDTNGDGVGDLRGIITKLDYIASLNVDAIWISPFFKSPMA
DFGYDISDYREIDPLFGSMQDFDELIEKAHQRGIKVIIDQVLSHTSDQHAWFIESRESRT
NPKADWYVWADPREDGTPPNNWLAIFGGCAWEWEPRRQQYYLHNFLRSQPDINFHNPDVR
QAVLDNVEFWLKKGVDGFRLDAITFCFHDELLRDNPAKPKEKRQGRGFSEDNPYAYQYHY
YNNDRPQTIQFIEALRQLINRYPGTVTLGEVSAEDSLAVMAAYTKGDDRLHMAYSFELLT
DDYSAAYIRQTVEALENSIGDGWPCWAIGNHDVQRVASRWGRGKQTSDMAKMLNAMLCSL
RGSVCSYQGEELGLTEVPIEFHELQDPFGKTFWPMFKGRDGCRTPMPWEQYADFSGFSQV
SPWLPIAAAHRALAVDLQEADCHSVLHGYRQFLAWRKCYPALITSEIEFLDAPEPLLVFV
RKLGEQKLLVCFNLLDAETQLSLTGLKLQQELAGHGLKTAHRQGDSLIFSAYASFYALLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory