Comparing 201408 SO2258 lipoprotein releasing system ATP-binding protein LolD (NCBI ptt file) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
58% identity, 97% coverage: 1:223/230 of query aligns to 1:223/233 of P75957
7mdyC Lolcde nucleotide-bound
58% identity, 96% coverage: 4:223/230 of query aligns to 1:220/226 of 7mdyC
7arlD Lolcde in complex with lipoprotein and adp (see paper)
58% identity, 96% coverage: 4:223/230 of query aligns to 1:220/222 of 7arlD
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
58% identity, 96% coverage: 4:223/230 of query aligns to 3:222/229 of 7v8iD
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
42% identity, 98% coverage: 5:230/230 of query aligns to 3:226/226 of 5xu1B
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
48% identity, 87% coverage: 23:221/230 of query aligns to 17:214/223 of 2pclA
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
45% identity, 94% coverage: 5:221/230 of query aligns to 4:219/648 of P75831
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
40% identity, 94% coverage: 5:221/230 of query aligns to 3:218/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
40% identity, 94% coverage: 5:221/230 of query aligns to 3:218/592 of 5lj7A
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
42% identity, 94% coverage: 5:221/230 of query aligns to 4:219/650 of 5ws4A
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
39% identity, 97% coverage: 5:228/230 of query aligns to 1:228/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
38% identity, 97% coverage: 5:228/230 of query aligns to 1:228/230 of 1l2tA
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
39% identity, 96% coverage: 5:224/230 of query aligns to 1:216/219 of 8w6iD
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
39% identity, 96% coverage: 5:224/230 of query aligns to 1:216/222 of P0A9R7
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
38% identity, 95% coverage: 5:223/230 of query aligns to 1:215/222 of 8i6rB
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
38% identity, 96% coverage: 5:224/230 of query aligns to 1:216/218 of 8hd0A
8g4cB Bceabs atpgs high res tm (see paper)
34% identity, 99% coverage: 4:230/230 of query aligns to 2:230/248 of 8g4cB
7tchB Bceab e169q variant atp-bound conformation (see paper)
33% identity, 99% coverage: 4:230/230 of query aligns to 1:229/245 of 7tchB
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 95% coverage: 5:223/230 of query aligns to 1:219/343 of P30750
Sites not aligning to the query:
7w78A Heme exporter hrtba in complex with mg-amppnp (see paper)
41% identity, 94% coverage: 5:221/230 of query aligns to 4:213/218 of 7w78A
>201408 SO2258 lipoprotein releasing system ATP-binding protein LolD (NCBI ptt file)
MQDVLLQVQAVSKSYHDGDVTTQVLSDVDLQVFKGEQLAIVGTSGSGKSTLLHIMGTLDK
PSSGKVLLAGEDLYQVSSARQAQIRNQDLGFIYQFHHLLPEFTALENVAMPAFIQGRDRT
LAQADAKVLLERVGLGHRMSHIPAELSGGERQRVAIARALINKPKLVLADEPTGNLDAKS
GEAVYELIRELANQLGTAFVVVTHDPKLAARMDRQLTMKNGYLQVPESAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory