SitesBLAST
Comparing 201483 FitnessBrowser__MR1:201483 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P12694 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial; Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain; BCKDE1A; BCKDH E1-alpha; EC 1.2.4.4 from Homo sapiens (Human) (see 14 papers)
50% identity, 93% coverage: 24:386/392 of query aligns to 76:439/445 of P12694
- Y158 (= Y106) binding
- R159 (= R107) binding ; to W: in MSUD1A; loss of 3-methyl-2-oxobutanoate dehydrogenase activity; dbSNP:rs769688327
- Q190 (= Q138) to K: in MSUD1A; decreased 3-methyl-2-oxobutanoate dehydrogenase activity
- S206 (= S154) binding
- S207 (= S155) binding
- P208 (= P156) binding
- T211 (= T159) binding ; to M: in MSUD1A; loss of 3-methyl-2-oxobutanoate dehydrogenase activity; dbSNP:rs398123503
- Q212 (= Q160) binding
- E238 (= E186) binding
- G239 (= G187) binding
- A240 (= A188) binding
- G249 (= G197) to S: in MSUD1A; no effect on solubility; no effect on mitochondrial alpha-ketoglutarate dehydrogenase complex assembly; loss of 3-methyl-2-oxobutanoate dehydrogenase activity; dbSNP:rs137852874
- A253 (= A201) to T: in MSUD1A; loss of 3-methyl-2-oxobutanoate dehydrogenase activity; dbSNP:rs199599175
- A254 (= A202) to D: in MSUD1A; uncertain significance; loss of 3-methyl-2-oxobutanoate dehydrogenase activity
- R265 (= R213) binding ; to W: in MSUD1A; uncertain significance; no effect on solubility; no effect on mitochondrial alpha-ketoglutarate dehydrogenase complex assembly; loss of 3-methyl-2-oxobutanoate dehydrogenase activity; dbSNP:rs137852873
- N267 (= N215) binding ; to S: in MSUD1A; uncertain significance; no effect on solubility; no effect on mitochondrial alpha-ketoglutarate dehydrogenase complex assembly; decreased affinity for the cofactor thiamine diphosphate; decreased 3-methyl-2-oxobutanoate dehydrogenase activity
- Y269 (= Y217) binding
- A285 (= A233) to P: in MSUD1A; no effect on solubility; no effect on mitochondrial alpha-ketoglutarate dehydrogenase complex assembly; loss of 3-methyl-2-oxobutanoate dehydrogenase activity; dbSNP:rs398123508
- G290 (= G238) to R: in MSUD1A; no effect on solubility; no effect on mitochondrial alpha-ketoglutarate dehydrogenase complex assembly; decreased 3-methyl-2-oxobutanoate dehydrogenase activity; dbSNP:rs137852871
- R297 (= R245) to H: in MSUD1A; uncertain significance; decreased affinity for the cofactor thiamine diphosphate; decreased 3-methyl-2-oxobutanoate dehydrogenase activity; dbSNP:rs200137189
- T310 (= T258) to R: in MSUD1A; decreased solubility; changed mitochondrial alpha-ketoglutarate dehydrogenase complex assembly; loss of 3-methyl-2-oxobutanoate dehydrogenase activity; dbSNP:rs137852875
- I326 (= I274) to T: in MSUD1A; decreased 3-methyl-2-oxobutanoate dehydrogenase activity
- H336 (= H284) binding
- S337 (= S285) modified: Phosphoserine; by BCKDK; mutation to A: Substantially decreases the stability of the BCKD complex.
- S347 (= S295) mutation to A: Does not affect the stability of the BCKD complex.
- F409 (≠ I356) to C: in MSUD1A; decreased solubility; loss of mitochondrial alpha-ketoglutarate dehydrogenase complex assembly; loss of 3-methyl-2-oxobutanoate dehydrogenase activity; dbSNP:rs137852872
- Y413 (= Y360) to C: in MSUD1A; uncertain significance; decreased solubility; changed mitochondrial alpha-ketoglutarate dehydrogenase complex assembly; loss of 3-methyl-2-oxobutanoate dehydrogenase activity; dbSNP:rs398123508
- Y438 (= Y385) to N: in MSUD1A; decreased solubility; loss of mitochondrial alpha-ketoglutarate dehydrogenase complex assembly; loss of 3-methyl-2-oxobutanoate dehydrogenase activity; dbSNP:rs137852870
Sites not aligning to the query:
- 1:45 modified: transit peptide, Mitochondrion
2bffA Reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch (see paper)
49% identity, 93% coverage: 24:386/392 of query aligns to 26:386/392 of 2bffA
- active site: E71 (≠ G69), S157 (= S155), R282 (= R280), H286 (= H284), S287 (= S285), Y295 (= Y293)
- binding manganese (ii) ion: E188 (= E186), N217 (= N215), Y219 (= Y217)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: Q107 (= Q105), Y108 (= Y106), R109 (= R107), L159 (= L157), G187 (= G185), E188 (= E186), G189 (= G187), A190 (= A188), R215 (= R213), N217 (= N215), Y219 (= Y217), A220 (= A218), I221 (= I219), H286 (= H284)
2bewA Reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch (see paper)
49% identity, 93% coverage: 24:386/392 of query aligns to 26:384/390 of 2bewA
- active site: E71 (≠ G69), S157 (= S155), R282 (= R280), H286 (= H284), S287 (= S285), Y295 (= Y293)
- binding manganese (ii) ion: E188 (= E186), N217 (= N215), Y219 (= Y217), A220 (= A218)
- binding c2-1-hydroxyphenyl-thiamin diphosphate: M82 (= M80), Q107 (= Q105), Y108 (= Y106), R109 (= R107), L159 (= L157), G187 (= G185), E188 (= E186), G189 (= G187), A190 (= A188), R215 (= R213), N217 (= N215), Y219 (= Y217), A220 (= A218), I221 (= I219), H286 (= H284)
2bevA Reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch (see paper)
49% identity, 93% coverage: 24:386/392 of query aligns to 26:384/390 of 2bevA
- active site: E71 (≠ G69), S157 (= S155), R282 (= R280), H286 (= H284), S287 (= S285), Y295 (= Y293)
- binding manganese (ii) ion: E188 (= E186), N217 (= N215), Y219 (= Y217), A220 (= A218)
- binding c2-1-hydroxy-2-methyl-butyl-thiamin diphosphate: F80 (= F78), Q107 (= Q105), Y108 (= Y106), R109 (= R107), S157 (= S155), L159 (= L157), G187 (= G185), E188 (= E186), G189 (= G187), A190 (= A188), R215 (= R213), N217 (= N215), Y219 (= Y217), A220 (= A218), I221 (= I219), H286 (= H284)
2beuA Reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch (see paper)
49% identity, 93% coverage: 24:386/392 of query aligns to 26:384/390 of 2beuA
- active site: E71 (≠ G69), S157 (= S155), R282 (= R280), H286 (= H284), S287 (= S285), Y295 (= Y293)
- binding manganese (ii) ion: E188 (= E186), N217 (= N215), Y219 (= Y217), A220 (= A218)
- binding c2-1-hydroxy-3-methyl-propyl-thiamin diphosphate: Q107 (= Q105), Y108 (= Y106), R109 (= R107), S157 (= S155), L159 (= L157), G187 (= G185), E188 (= E186), G189 (= G187), A190 (= A188), R215 (= R213), N217 (= N215), Y219 (= Y217), A220 (= A218), I221 (= I219), H286 (= H284)
1wciA Reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch (see paper)
49% identity, 93% coverage: 24:386/392 of query aligns to 26:382/388 of 1wciA
- active site: E71 (≠ G69), S157 (= S155), R282 (= R280), H286 (= H284), S287 (= S285), Y295 (= Y293)
- binding manganese (ii) ion: E188 (= E186), N217 (= N215), Y219 (= Y217), A220 (= A218)
- binding c2-1-hydroxy-3-methyl-butyl-thiamin: Q107 (= Q105), Y108 (= Y106), R109 (= R107), L159 (= L157), G187 (= G185), E188 (= E186), G189 (= G187), A190 (= A188), R215 (= R213), N217 (= N215), Y219 (= Y217), A220 (= A218), I221 (= I219), H286 (= H284)
P11960 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial; Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain; BCKDE1A; BCKDH E1-alpha; EC 1.2.4.4 from Rattus norvegicus (Rat) (see paper)
49% identity, 93% coverage: 24:386/392 of query aligns to 72:435/441 of P11960
- S333 (= S285) modified: Phosphoserine; by BCKDK
1dtwA Human branched-chain alpha-keto acid dehydrogenase (see paper)
49% identity, 93% coverage: 24:386/392 of query aligns to 25:376/382 of 1dtwA
- active site: E70 (≠ G69), S156 (= S155), R281 (= R280), H285 (= H284), S286 (= S285), Y294 (= Y293)
- binding potassium ion: S155 (= S154), S156 (= S155), P157 (= P156), T160 (= T159), Q161 (= Q160)
- binding magnesium ion: E187 (= E186), N216 (= N215), Y218 (= Y217)
- binding thiamine diphosphate: Q106 (= Q105), Y107 (= Y106), R108 (= R107), L158 (= L157), G186 (= G185), E187 (= E186), G188 (= G187), A189 (= A188), R214 (= R213), N216 (= N215), Y218 (= Y217), A219 (= A218), I220 (= I219), H285 (= H284)
1v1mA Crosstalk between cofactor binding and the phosphorylation loop conformation in the bckd machine (see paper)
47% identity, 93% coverage: 24:386/392 of query aligns to 26:366/372 of 1v1mA
- active site: E71 (≠ G69), S157 (= S155), R282 (= R280)
- binding manganese (ii) ion: E188 (= E186), N217 (= N215), Y219 (= Y217)
- binding thiamine diphosphate: R109 (= R107), L159 (= L157), G187 (= G185), E188 (= E186), G189 (= G187), A190 (= A188), R215 (= R213), N217 (= N215), Y219 (= Y217), A220 (= A218), I221 (= I219)
1oluA Roles of his291-alpha and his146-beta' in the reductive acylation reaction catalyzed by human branched-chain alpha-ketoacid dehydrogenase (see paper)
46% identity, 95% coverage: 16:386/392 of query aligns to 10:360/366 of 1oluA
- active site: E67 (≠ G69), S153 (= S155), R278 (= R280)
- binding magnesium ion: E184 (= E186), N213 (= N215), Y215 (= Y217)
- binding thiamine diphosphate: R105 (= R107), L155 (= L157), G183 (= G185), E184 (= E186), G185 (= G187), A186 (= A188), N213 (= N215), A216 (= A218), I217 (= I219)
2bfcA Reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch (see paper)
46% identity, 93% coverage: 24:386/392 of query aligns to 26:365/371 of 2bfcA
- active site: E71 (≠ G69), S157 (= S155), R282 (= R280)
- binding manganese (ii) ion: E188 (= E186), N217 (= N215), Y219 (= Y217)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: R109 (= R107), L159 (= L157), G187 (= G185), E188 (= E186), G189 (= G187), A190 (= A188), R215 (= R213), N217 (= N215), Y219 (= Y217), A220 (= A218), I221 (= I219)
3dufA Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
36% identity, 93% coverage: 17:380/392 of query aligns to 10:365/365 of 3dufA
- active site: S62 (≠ G69), I139 (≠ T152), R264 (= R280), H268 (= H284), T269 (≠ S285), Y278 (= Y293)
- binding magnesium ion: D170 (≠ E186), N199 (= N215), F201 (≠ Y217)
- binding 2-{4-[(4-amino-2-methylpyrimidin-5-yl)methyl]-5-[(1r)-1-hydroxyethyl]-3-methyl-2-thienyl}ethyl trihydrogen diphosphate: Y99 (= Y106), R100 (= R107), I141 (≠ L157), G169 (= G185), D170 (≠ E186), G171 (= G187), N199 (= N215), F201 (≠ Y217), A202 (= A218), H268 (= H284)
1qs0A Crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b) (see paper)
37% identity, 91% coverage: 18:374/392 of query aligns to 45:407/407 of 1qs0A
- active site: V95 (≠ G69), G181 (≠ S155), R307 (= R280), H311 (= H284), S312 (= S285), Y320 (= Y293)
- binding magnesium ion: D212 (≠ E186), N241 (= N215), W243 (≠ Y217)
- binding thiamine diphosphate: Y132 (= Y106), R133 (= R107), L183 (= L157), G211 (= G185), D212 (≠ E186), G213 (= G187), A214 (= A188), N241 (= N215), W243 (≠ Y217), A244 (= A218), I245 (= I219), H311 (= H284)
1w85A The crystal structure of pyruvate dehydrogenase e1 bound to the peripheral subunit binding domain of e2 (see paper)
36% identity, 92% coverage: 17:376/392 of query aligns to 10:355/358 of 1w85A
- active site: S62 (≠ G69), I139 (≠ T152), R264 (= R280), H268 (= H284), T269 (≠ S285)
- binding magnesium ion: D170 (≠ E186), N199 (= N215), F201 (≠ Y217)
- binding thiamine diphosphate: Y99 (= Y106), R100 (= R107), I139 (≠ T152), I141 (≠ L157), G169 (= G185), D170 (≠ E186), G171 (= G187), G172 (≠ A188), N199 (= N215), A202 (= A218), I203 (= I219), H268 (= H284)
Q5SLR4 2-oxoisovalerate dehydrogenase subunit alpha; Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain; BCKDH E1-alpha; EC 1.2.4.4 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
38% identity, 83% coverage: 52:378/392 of query aligns to 40:367/367 of Q5SLR4
1umdA Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate (see paper)
38% identity, 83% coverage: 52:378/392 of query aligns to 35:362/362 of 1umdA
- active site: I52 (≠ G69), S139 (= S155), R264 (= R280), H268 (= H284), S269 (= S285), Y277 (= Y293)
- binding 2-oxo-4-methylpentanoic acid: F61 (= F78), Y90 (= Y106), S139 (= S155)
- binding magnesium ion: D170 (≠ E186), N199 (= N215), Y201 (= Y217)
- binding thiamine diphosphate: Y89 (≠ Q105), Y90 (= Y106), R91 (= R107), P140 (= P156), I141 (≠ L157), G169 (= G185), D170 (≠ E186), G171 (= G187), N199 (= N215), Y201 (= Y217), A202 (= A218), I203 (= I219), H268 (= H284)
1umcA Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methylpentanoate (see paper)
38% identity, 83% coverage: 52:378/392 of query aligns to 35:362/362 of 1umcA
- active site: I52 (≠ G69), S139 (= S155), R264 (= R280), H268 (= H284), S269 (= S285), Y277 (= Y293)
- binding 4-methyl valeric acid: Y90 (= Y106), H126 (= H142)
- binding magnesium ion: D170 (≠ E186), N199 (= N215), Y201 (= Y217)
- binding thiamine diphosphate: Y89 (≠ Q105), Y90 (= Y106), R91 (= R107), I141 (≠ L157), G169 (= G185), D170 (≠ E186), G171 (= G187), N199 (= N215), Y201 (= Y217), I203 (= I219), H268 (= H284)
1umbA Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 in holo-form (see paper)
38% identity, 83% coverage: 52:378/392 of query aligns to 35:362/362 of 1umbA
- active site: I52 (≠ G69), S139 (= S155), R264 (= R280), H268 (= H284), S269 (= S285), Y277 (= Y293)
- binding magnesium ion: D170 (≠ E186), N199 (= N215), Y201 (= Y217)
- binding thiamine diphosphate: Y89 (≠ Q105), Y90 (= Y106), R91 (= R107), P140 (= P156), I141 (≠ L157), G169 (= G185), D170 (≠ E186), G171 (= G187), N199 (= N215), Y201 (= Y217), A202 (= A218), I203 (= I219), H268 (= H284)
3dv0A Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
34% identity, 92% coverage: 17:376/392 of query aligns to 10:346/349 of 3dv0A
- active site: S62 (≠ G69), I139 (≠ T152), R264 (= R280), H268 (= H284)
- binding magnesium ion: D170 (≠ E186), N199 (= N215), F201 (≠ Y217)
- binding 2-{4-[(4-amino-2-methylpyrimidin-5-yl)methyl]-3-methylthiophen-2-yl}ethyl trihydrogen diphosphate: Y99 (= Y106), R100 (= R107), I141 (≠ L157), G169 (= G185), D170 (≠ E186), G171 (= G187), N199 (= N215), F201 (≠ Y217), A202 (= A218), I203 (= I219), R264 (= R280)
3dv0E Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
33% identity, 92% coverage: 17:376/392 of query aligns to 10:341/344 of 3dv0E
- active site: S62 (≠ G69), I139 (≠ T152), R264 (= R280)
- binding magnesium ion: G169 (= G185), D170 (≠ E186), Q197 (≠ R213), N199 (= N215)
- binding 2-{4-[(4-amino-2-methylpyrimidin-5-yl)methyl]-3-methylthiophen-2-yl}ethyl trihydrogen diphosphate: Y99 (= Y106), R100 (= R107), I139 (≠ T152), I141 (≠ L157), G169 (= G185), D170 (≠ E186), G171 (= G187), N199 (= N215), F201 (≠ Y217), A202 (= A218), I203 (= I219)
Query Sequence
>201483 FitnessBrowser__MR1:201483
MSKATLNTDTVHRVGFLDKASLHIPILRILQADGTTYETAVLPVIDEALAIKIYDTCVFT
RVLDERMLGAQRQGRISFYMTCTGEEAAIVGSVAALDPEDVILAQYREHAALRYRGFTTE
QFMNQMFSNEKDLGKGRQMPIHYGCAALNYQTISSPLATQIPQATGVGYSLKMQGKRNVA
VCYFGEGAASEGDFHAGLNMAAVLKCPVIFFCRNNGYAISTPTEEQFAGNGIASRGVGYG
MHTIRVDGNDMLAVLAATQQARAYAIEHNAPVLIEAMTYRLGAHSSSDDPSGYRSKEEEA
KWQQHDPVKRFKLWLINKGWLAEADDAQRYEKYREEVLAAVKVAEKLPIPMLDEIIEDVY
DKPTPALKKQLSELKEHIKKYPQSYPKSAGRL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory