SitesBLAST
Comparing 201541 FitnessBrowser__MR1:201541 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4fc7A Studies on dcr shed new light on peroxisomal beta-oxidation: crystal structure of the ternary complex of pdcr (see paper)
44% identity, 89% coverage: 10:254/275 of query aligns to 24:269/274 of 4fc7A
- active site: G36 (= G22), A162 (= A148), Q172 (= Q158), H174 (= H160), A175 (≠ V161), K179 (= K165)
- binding coenzyme a: R57 (= R43), R85 (= R72), G113 (= G100), N114 (= N101), F115 (= F102), S123 (≠ T110), N125 (= N112), A126 (≠ G113), T129 (≠ A116), R216 (= R202)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G32 (= G18), S35 (= S21), G36 (= G22), I37 (= I23), S56 (= S42), R57 (= R43), S58 (= S44), R61 (≠ K47), D83 (= D70), V84 (= V71), R85 (= R72), C110 (≠ G97), A111 (= A98), A112 (= A99), I160 (= I146), K179 (= K165), P205 (= P191), G206 (= G192), T211 (= T197), E212 (= E198), G213 (= G199)
Q9NUI1 Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing]; pDCR; 2,4-dienoyl-CoA reductase 2; Short chain dehydrogenase/reductase family 17C member 1; EC 1.3.1.124 from Homo sapiens (Human) (see paper)
44% identity, 89% coverage: 10:254/275 of query aligns to 27:272/292 of Q9NUI1
- GGGSGI 35:40 (≠ GGTSGI 18:23) binding
- RSLPR 60:64 (≠ RSQDK 43:47) binding
- D86 (= D70) binding ; mutation to A: Reduces enzyme activity by 98%.
- D137 (= D121) mutation to A: Reduces enzyme activity by 97%.
- K182 (= K165) binding
- D186 (= D169) mutation to A: Reduces enzyme activity by about 95%.
- 208:214 (vs. 191:197, 86% identical) binding
- D268 (= D251) mutation to A: Reduces enzyme activity by 97%.
4fc6B Studies on dcr shed new light on peroxisomal beta-oxidation: crystal structure of the ternary complex of pdcr (see paper)
44% identity, 89% coverage: 10:254/275 of query aligns to 25:270/276 of 4fc6B
- active site: G37 (= G22), A163 (= A148), Q173 (= Q158), H175 (= H160), A176 (≠ V161), K180 (= K165)
- binding hexanoyl-coenzyme a: G114 (= G100), N115 (= N101), F116 (= F102), S124 (≠ T110), N126 (= N112), A127 (≠ G113), T130 (≠ A116), L165 (≠ Q150), R217 (= R202)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G33 (= G18), S36 (= S21), G37 (= G22), I38 (= I23), S57 (= S42), R58 (= R43), S59 (= S44), R62 (≠ K47), M83 (≠ F69), D84 (= D70), V85 (= V71), C111 (≠ G97), A112 (= A98), A113 (= A99), I134 (= I120), I161 (= I146), K180 (= K165), P206 (= P191), G207 (= G192), T212 (= T197), E213 (= E198), G214 (= G199)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
33% identity, 91% coverage: 6:255/275 of query aligns to 1:250/252 of 1vl8B
- active site: G17 (= G22), S143 (= S147), I154 (≠ Q158), Y157 (≠ V161), K161 (= K165)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G18), R16 (≠ S21), G17 (= G22), L18 (≠ I23), S37 (= S42), R38 (= R43), C63 (≠ F69), D64 (= D70), V65 (= V71), A91 (≠ G97), A92 (= A98), G93 (≠ A99), I94 (≠ G100), V114 (≠ I120), I141 (= I146), S143 (= S147), Y157 (≠ V161), K161 (= K165), P187 (= P191), G188 (= G192), Y190 (≠ I194), T192 (≠ N201), M194 (≠ L203), T195 (≠ A204)
Q9BY49 Peroxisomal trans-2-enoyl-CoA reductase; TERP; 2,4-dienoyl-CoA reductase-related protein; DCR-RP; HPDHase; Short chain dehydrogenase/reductase family 29C member 1; pVI-ARL; EC 1.3.1.38 from Homo sapiens (Human) (see paper)
33% identity, 90% coverage: 10:256/275 of query aligns to 17:267/303 of Q9BY49
Sites not aligning to the query:
- 303 mutation Missing: Abolishes localization to peroxisomes.
1yxmB Crystal structure of peroxisomal trans 2-enoyl coa reductase
33% identity, 90% coverage: 10:256/275 of query aligns to 10:252/283 of 1yxmB
- active site: G22 (= G22), V152 (≠ A148), G157 (≠ A154), H163 (= H160), S164 (≠ V161), R168 (≠ K165)
- binding adenine: S42 (= S42), R43 (= R43), C72 (≠ F69), N73 (≠ D70), I74 (≠ V71), T123 (≠ I120)
5fffA Noroxomaritidine/norcraugsodine reductase in complex with NADP+ and piperonal (see paper)
33% identity, 92% coverage: 7:258/275 of query aligns to 7:257/257 of 5fffA
- active site: K206 (≠ S206)
- binding 1,3-benzodioxole-5-carbaldehyde: Y100 (≠ N101), H158 (≠ Q158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G18), T20 (= T20), G22 (= G22), I23 (= I23), R43 (= R43), C67 (≠ F69), D68 (= D70), V69 (= V71), N96 (≠ G97), I146 (= I146), Y161 (≠ V161), K165 (= K165), P191 (= P191), A193 (≠ P193), I194 (= I194), T196 (vs. gap), G198 (= G196), T199 (= T197)
5ff9B Noroxomaritidine/norcraugsodine reductase in complex with NADP+ and tyramine (see paper)
33% identity, 92% coverage: 7:258/275 of query aligns to 7:257/257 of 5ff9B
- active site: K206 (≠ S206)
- binding 4-(2-aminoethyl)phenol: Y100 (≠ N101), I155 (≠ M155), H158 (≠ Q158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G18), T20 (= T20), K21 (≠ S21), I23 (= I23), S42 (= S42), R43 (= R43), C67 (≠ F69), D68 (= D70), V69 (= V71), N96 (≠ G97), I146 (= I146), S148 (≠ A148), Y161 (≠ V161), K165 (= K165), P191 (= P191), A193 (≠ P193), I194 (= I194), T196 (vs. gap), G198 (= G196), T199 (= T197)
A0A1A9TAK5 Noroxomaritidine/norcraugsodine reductase; NorRed; EC 1.1.1.- from Narcissus pseudonarcissus (Daffodil) (see paper)
33% identity, 92% coverage: 7:258/275 of query aligns to 7:257/257 of A0A1A9TAK5
3pk0B Crystal structure of short-chain dehydrogenase/reductase sdr from mycobacterium smegmatis (see paper)
37% identity, 92% coverage: 5:256/275 of query aligns to 4:253/262 of 3pk0B
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
33% identity, 89% coverage: 12:256/275 of query aligns to 5:246/246 of 3osuA
Q16698 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing], mitochondrial; 2,4-dienoyl-CoA reductase [NADPH]; 4-enoyl-CoA reductase [NADPH]; Short chain dehydrogenase/reductase family 18C member 1; EC 1.3.1.124 from Homo sapiens (Human) (see paper)
31% identity, 89% coverage: 8:253/275 of query aligns to 56:302/335 of Q16698
- GGGTGL 66:71 (≠ GGTSGI 18:23) binding
- R91 (= R43) binding
- D117 (= D70) binding
- R119 (= R72) binding
- N148 (= N101) mutation to A: Reduces enzyme activity by 97%.
- F149 (= F102) binding
- S157 (≠ T110) binding
- Y199 (≠ Q150) mutation to A: Reduces enzyme activity by 99%. Strongly reduced affinity for substrate and for NADP.
- S210 (≠ V161) mutation to A: Reduces enzyme activity by over 99%.
- K214 (= K165) binding ; mutation to A: Reduces enzyme activity by over 99%.
- PGPI 240:243 (= PGPI 191:194) binding
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
31% identity, 89% coverage: 8:253/275 of query aligns to 4:249/261 of P40288
- 11:35 (vs. 15:39, 36% identical) binding
- E96 (≠ N101) mutation E->A,G,K: Heat stable.
- D108 (≠ G113) mutation to N: Heat stable.
- V112 (= V117) mutation to A: Heat stable.
- E133 (≠ L136) mutation to K: Heat stable.
- V183 (≠ I186) mutation to I: Heat stable.
- P194 (≠ T197) mutation to Q: Heat stable.
- E210 (≠ A214) mutation to K: Heat stable.
- Y217 (≠ R221) mutation to H: Heat stable.
Sites not aligning to the query:
- 252 Q→L: Heat stable.
- 253 Y→C: Heat stable.
- 258 A→G: Heat stable.
7ucwB Structure of mouse decr1 in complex with 2'-5' oligoadenylate (see paper)
32% identity, 89% coverage: 9:253/275 of query aligns to 23:257/281 of 7ucwB
- binding [[(2R,3R,4R,5R)-5-(6-aminopurin-9-yl)-4-[[(2R,3R,4R,5R)-5-(6-aminopurin-9-yl)-4-[[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-3-hydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-3-hydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl] phosphono hydrogen phosphate: G32 (= G18), T35 (≠ S21), S56 (= S42), R57 (= R43), N58 (≠ S44), D83 (= D70), V84 (= V71), A111 (= A98), A112 (= A99), I133 (= I120)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
35% identity, 90% coverage: 6:253/275 of query aligns to 2:241/244 of 4nbuB
- active site: G18 (= G22), N111 (≠ D121), S139 (≠ A148), Q149 (= Q158), Y152 (≠ V161), K156 (= K165)
- binding acetoacetyl-coenzyme a: D93 (≠ P103), K98 (= K108), S139 (≠ A148), N146 (≠ M155), V147 (≠ P156), Q149 (= Q158), Y152 (≠ V161), F184 (≠ I194), M189 (≠ G199), K200 (≠ Q211)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G18), N17 (≠ S21), G18 (= G22), I19 (= I23), D38 (= D46), F39 (≠ K47), V59 (vs. gap), D60 (= D70), V61 (= V71), N87 (≠ G97), A88 (= A98), G89 (≠ A99), I90 (≠ G100), T137 (≠ I146), S139 (≠ A148), Y152 (≠ V161), K156 (= K165), P182 (= P191), F184 (≠ I194), T185 (= T195), T187 (= T197), M189 (≠ G199)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
33% identity, 89% coverage: 12:256/275 of query aligns to 2:239/239 of 3sj7A
- active site: G12 (= G22), S138 (≠ A148), Q148 (= Q158), Y151 (≠ V161), K155 (= K165)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G18), S10 (≠ T20), R11 (≠ S21), I13 (= I23), N31 (vs. gap), Y32 (≠ A41), A33 (≠ S42), G34 (≠ R43), S35 (= S44), A58 (≠ F69), N59 (≠ D70), V60 (= V71), N86 (≠ G97), A87 (= A98), T109 (≠ I120), S138 (≠ A148), Y151 (≠ V161), K155 (= K165), P181 (= P191), G182 (= G192)
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
31% identity, 89% coverage: 8:253/275 of query aligns to 4:249/261 of 1g6kA
- active site: G18 (= G22), S145 (≠ A148), Y158 (≠ V161), K162 (= K165)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ S21), G18 (= G22), L19 (≠ I23), R39 (= R43), D65 (≠ H64), V66 (≠ L65), N92 (≠ G97), A93 (= A98), G94 (≠ A99), M143 (≠ I146), S145 (≠ A148), Y158 (≠ V161), P188 (= P191), G189 (= G192), I191 (= I194), T193 (≠ G196)
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
35% identity, 90% coverage: 10:256/275 of query aligns to 4:239/239 of 4nbtA
- active site: G16 (= G22), S132 (≠ A148), Y145 (≠ V161), K149 (= K165)
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), K15 (≠ S21), G16 (= G22), L17 (≠ I23), D36 (≠ R43), L37 (≠ S44), L52 (= L65), N53 (≠ G66), V54 (= V67), N80 (≠ G97), A81 (= A98), G82 (≠ A99), I130 (= I146), S132 (≠ A148), Y145 (≠ V161), K149 (= K165), P177 (= P191), G178 (= G192), I180 (= I194), T182 (≠ E198)
P9WGT3 3-oxoacyl-[acyl-carrier-protein] reductase MabA; 3-ketoacyl reductase; 3-ketoacyl-acyl carrier protein reductase; Acetoacetyl-CoA reductase; Beta-ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; Mycolic acid biosynthesis A; EC 1.1.1.100; EC 1.1.1.36 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 7 papers)
35% identity, 91% coverage: 9:257/275 of query aligns to 13:246/247 of P9WGT3
- T21 (≠ V17) modified: Phosphothreonine; mutation to A: Slight decrease in phosphorylation by PknB. Lack of phosphorylation by PknB; when associated with A-114 and A-191.
- RGI 25:27 (≠ SGI 21:23) binding
- R47 (= R43) binding
- C60 (≠ F69) mutation to V: Displays a lower activity than the wild-type and a slightly decreased affinity for the cofactor. Retains 84% of activity; when associated with L-144. Totally inactive; when associated with A-139 and L-144.
- DV 61:62 (= DV 70:71) binding
- G90 (≠ A99) binding
- T114 (≠ L123) modified: Phosphothreonine; mutation to A: Slight decrease in phosphorylation by PknB. Lack of phosphorylation by PknB; when associated with A-21 and A-191.
- G139 (≠ S147) mutation to A: Complete protein inactivation and freezes the catalytic site into its closed form. Totally inactive; when associated with V-60 and L-144.
- S140 (≠ A148) mutation to A: Loss of activity. Can still bind NADPH.; mutation to T: Loss of activity. Impaired NADPH binding.
- S144 (= S152) mutation to L: Stabilizes the catalytic loop in its open active form. Retains 84% of activity; when associated with V-60. Totally inactive; when associated with V-60 and A-139.
- Y185 (≠ P193) mutation to L: 70% decrease in activity with acetoacetyl-CoA as substrate. Does not affect NADP binding.
- T191 (≠ F200) modified: Phosphothreonine; mutation to A: Retains 22% of wild-type reductase activity. Strong decrease in phosphorylation by PknB. Lack of phosphorylation by PknB; when associated with A-21 and A-114.; mutation to D: Phosphomimetic mutant that retains less than 10% of wild-type reductase activity. Impaired NADPH binding. Overproduction of the mutant leads to a significant inhibition of de novo biosynthesis of mycolic acids.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3o03A Quaternary complex structure of gluconate 5-dehydrogenase from streptococcus suis type 2 (see paper)
33% identity, 90% coverage: 7:253/275 of query aligns to 7:245/254 of 3o03A
- active site: G22 (= G22), S147 (≠ A148), V157 (≠ Q158), Y160 (≠ V161), K164 (= K165)
- binding calcium ion: S147 (≠ A148), M148 (≠ P149), P190 (= P191)
- binding D-gluconic acid: I99 (≠ N101), R101 (≠ P103), S147 (≠ A148), M149 (≠ Q150), R154 (≠ M155), Y160 (≠ V161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G18), Y21 (≠ S21), G22 (= G22), I23 (= I23), D42 (≠ S42), I43 (≠ R43), L47 (≠ K47), D68 (= D70), V69 (= V71), N95 (≠ G97), A96 (= A98), G97 (≠ A99), I145 (= I146), Y160 (≠ V161), K164 (= K165), P190 (= P191)
Query Sequence
>201541 FitnessBrowser__MR1:201541
MLNTTMFNYQGKNVVVVGGTSGINLAIAIAFAHAGANVAVASRSQDKVDAAVLQLKQAHP
EGIHLGVSFDVRDLVAVEQGFEAIASEFGFIDVLVSGAAGNFPATAAKLTANGFKAVMDI
DLLGSFQVLKTAYPLLRRPQGNIIQISAPQASIAMPMQAHVCAAKAGVDMLTRTLAIEWG
CEGIRINSIIPGPITGTEGFNRLAPSVVLQQQVAQSVPLKRNGEGQDIANAALFLGSELA
SYITGVVLPVDGGWSLGGASIAMTALGELAAKGSN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory