Comparing 201565 FitnessBrowser__MR1:201565 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A962 L-asparaginase 1; L-asparaginase I; L-ASNase I; L-asparagine amidohydrolase I; EC 3.5.1.1 from Escherichia coli (strain K12) (see paper)
69% identity, 100% coverage: 1:337/337 of query aligns to 1:337/338 of P0A962
6nxcB Ecai(t162a) mutant in complex with citrate at ph 4 (see paper)
68% identity, 100% coverage: 1:337/337 of query aligns to 8:336/336 of 6nxcB
2himA Crystal structure and allosteric regulation of the cytoplasmic escherichia coli l-asparaginase i (see paper)
67% identity, 99% coverage: 3:336/337 of query aligns to 1:324/324 of 2himA
7r6bB Crystal structure of mutant r43d/l124d/r125a/c273s of l-asparaginase i from yersinia pestis (see paper)
64% identity, 99% coverage: 3:335/337 of query aligns to 1:300/301 of 7r6bB
4r8lA Crystal structure of the asp-bound guinea pig l-asparaginase 1 catalytic domain (see paper)
40% identity, 99% coverage: 3:335/337 of query aligns to 1:352/354 of 4r8lA
5dndD Crystal structure of the asn-bound guinea pig l-asparaginase 1 catalytic domain active site mutant t116a (see paper)
40% identity, 99% coverage: 3:335/337 of query aligns to 1:352/357 of 5dndD
1zq1A Structure of gatde tRNA-dependent amidotransferase from pyrococcus abyssi (see paper)
32% identity, 97% coverage: 11:336/337 of query aligns to 98:428/437 of 1zq1A
4q0mA Crystal structure of pyrococcus furiosus l-asparaginase (see paper)
33% identity, 96% coverage: 12:334/337 of query aligns to 10:325/327 of 4q0mA
Q8TZE8 L-asparaginase; EC 3.5.1.1 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see 2 papers)
33% identity, 96% coverage: 12:334/337 of query aligns to 9:324/326 of Q8TZE8
5ot0A The thermostable l-asparaginase from thermococcus kodakarensis (see paper)
32% identity, 96% coverage: 11:335/337 of query aligns to 8:326/328 of 5ot0A
4njeA Crystal structure of pyrococcus furiosus l-asparaginase with ligand (see paper)
35% identity, 51% coverage: 12:182/337 of query aligns to 9:173/182 of 4njeA
5b5uA Crystal structure of truncated pyrococcus furiosus l-asparaginase with peptide (see paper)
35% identity, 51% coverage: 12:182/337 of query aligns to 9:173/175 of 5b5uA
Sites not aligning to the query:
7r5qA Escherichia coli type ii asparaginase n24s mutant in complex with glu (see paper)
29% identity, 79% coverage: 58:323/337 of query aligns to 36:300/306 of 7r5qA
P00805 L-asparaginase 2; L-asparaginase II; L-ASNase II; L-asparagine amidohydrolase II; Colaspase; EC 3.5.1.1 from Escherichia coli (strain K12) (see 5 papers)
29% identity, 79% coverage: 58:323/337 of query aligns to 78:342/348 of P00805
Sites not aligning to the query:
1ho3A Crystal structure analysis of e. Coli l-asparaginase ii (y25f mutant) (see paper)
29% identity, 79% coverage: 58:323/337 of query aligns to 56:320/326 of 1ho3A
Sites not aligning to the query:
7c8qA Blasnase-t13a with d-asn (see paper)
28% identity, 95% coverage: 3:323/337 of query aligns to 1:318/321 of 7c8qA
7c8xA Blasnase-t13a with l-asn (see paper)
28% identity, 95% coverage: 3:323/337 of query aligns to 1:317/319 of 7c8xA
1jazA Crystal structure of monoclinic form of d90e mutant of escherichia coli asparaginase ii (see paper)
29% identity, 79% coverage: 58:323/337 of query aligns to 37:301/307 of 1jazA
Sites not aligning to the query:
8h4aB Blasnase-t13a/m57p
27% identity, 97% coverage: 3:329/337 of query aligns to 1:324/328 of 8h4aB
7cbuA Blasnase-t13a with l-asp (see paper)
27% identity, 95% coverage: 3:323/337 of query aligns to 1:315/318 of 7cbuA
>201565 FitnessBrowser__MR1:201565
MTKRSIYVAYTGGTIGMQKTDNGFAPVAGFLTQCVQSMPEFYHAEMPEFVIHEYCPLIDS
SNMAPTDWQMIADDINANYDKYDGFVILHGTDTMAYTASALSFMLQGLSKPVIVTGSQIP
LAQLRSDGQTNLLNSLYIAANYPVAEVCLFFNNKLFRGNRSTKAHADGFDAFASPNFPLL
LEAGIKINLRAGKIATPSNNPLEVANISPQPVGVVTLYPGISTQIFENILQQPVKALILL
TFGVGNAPQDVALLRTLKQADERGIVLVNLTQCFQGKVNMGGYATGNALAKAGVISGADM
TIEAALAKLHYLLSKNLKPIEIKTAMLQNLVGELSPD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory