Comparing 201587 FitnessBrowser__MR1:201587 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P30138 Sulfur carrier protein ThiS adenylyltransferase; EC 2.7.7.73 from Escherichia coli (strain K12) (see 3 papers)
44% identity, 93% coverage: 11:290/300 of query aligns to 1:251/251 of P30138
1zfnA Structural analysis of escherichia coli thif (see paper)
44% identity, 90% coverage: 11:280/300 of query aligns to 1:244/244 of 1zfnA
1zud3 Structure of this-thif protein complex (see paper)
43% identity, 90% coverage: 11:280/300 of query aligns to 1:239/240 of 1zud3
Q9VLJ8 Adenylyltransferase and sulfurtransferase MOCS3; Molybdenum cofactor synthesis protein 3; Ubiquitin activating enzyme 4; EC 2.7.7.80; EC 2.8.1.11 from Drosophila melanogaster (Fruit fly) (see paper)
36% identity, 91% coverage: 9:280/300 of query aligns to 62:310/453 of Q9VLJ8
O59954 Adenylyltransferase and sulfurtransferase uba4; Common component for nitrate reductase and xanthine dehydrogenase protein F; Ubiquitin-like protein activator 4; EC 2.7.7.80; EC 2.8.1.11 from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see paper)
35% identity, 99% coverage: 2:299/300 of query aligns to 49:334/482 of O59954
P12282 Molybdopterin-synthase adenylyltransferase; MoaD protein adenylase; Molybdopterin-converting factor subunit 1 adenylase; Sulfur carrier protein MoaD adenylyltransferase; EC 2.7.7.80 from Escherichia coli (strain K12) (see 2 papers)
36% identity, 91% coverage: 9:280/300 of query aligns to 2:248/249 of P12282
1jwbB Structure of the covalent acyl-adenylate form of the moeb-moad protein complex (see paper)
36% identity, 91% coverage: 9:280/300 of query aligns to 1:240/240 of 1jwbB
1jw9B Structure of the native moeb-moad protein complex (see paper)
36% identity, 91% coverage: 9:280/300 of query aligns to 1:240/240 of 1jw9B
O95396 Adenylyltransferase and sulfurtransferase MOCS3; Molybdenum cofactor synthesis protein 3; Molybdopterin synthase sulfurylase; MPT synthase sulfurylase; EC 2.7.7.80; EC 2.8.1.11 from Homo sapiens (Human) (see 5 papers)
40% identity, 74% coverage: 8:228/300 of query aligns to 52:263/460 of O95396
Sites not aligning to the query:
6yubA Crystal structure of uba4 from chaetomium thermophilum (see paper)
36% identity, 74% coverage: 9:231/300 of query aligns to 4:215/423 of 6yubA
Sites not aligning to the query:
6yubB Crystal structure of uba4 from chaetomium thermophilum (see paper)
36% identity, 74% coverage: 9:231/300 of query aligns to 5:214/289 of 6yubB
Sites not aligning to the query:
1jwaB Structure of the atp-bound moeb-moad protein complex (see paper)
35% identity, 88% coverage: 9:272/300 of query aligns to 1:217/217 of 1jwaB
P38820 Adenylyltransferase and sulfurtransferase UBA4; Needs CLA4 to survive protein 3; Ubiquitin-like protein activator 4; EC 2.7.7.-; EC 2.8.1.- from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 4 papers)
32% identity, 75% coverage: 5:230/300 of query aligns to 33:251/440 of P38820
Sites not aligning to the query:
Q72J02 Sulfur carrier protein adenylyltransferase; E1-like protein TtuC; Sulfur carrier protein MoaD adenylyltransferase; Sulfur carrier protein ThiS adenylyltransferase; Sulfur carrier protein TtuB adenylyltransferase; tRNA two-thiouridine-synthesizing protein C; EC 2.7.7.80; EC 2.7.7.73; EC 2.7.7.- from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
32% identity, 93% coverage: 12:289/300 of query aligns to 4:264/271 of Q72J02
Sites not aligning to the query:
D4GSF3 SAMP-activating enzyme E1; Ubiquitin-like activating enzyme of archaea; Ubl-activating enzyme; EC 2.7.7.- from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) (Halobacterium volcanii) (see paper)
35% identity, 90% coverage: 10:280/300 of query aligns to 4:249/270 of D4GSF3
Q7SXG4 SUMO-activating enzyme subunit 2; Ubiquitin-like 1-activating enzyme E1B; Ubiquitin-like modifier-activating enzyme 2; EC 2.3.2.- from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
30% identity, 52% coverage: 36:192/300 of query aligns to 16:162/650 of Q7SXG4
Sites not aligning to the query:
6xoiB Structure of sumo1-ml00752641 adduct bound to sae (see paper)
29% identity, 52% coverage: 40:196/300 of query aligns to 12:158/403 of 6xoiB
Sites not aligning to the query:
6xogB Structure of sumo1-ml786519 adduct bound to sae (see paper)
29% identity, 53% coverage: 40:199/300 of query aligns to 12:160/500 of 6xogB
Sites not aligning to the query:
6xohB Structure of sumo1-ml00789344 adduct bound to sae (see paper)
29% identity, 53% coverage: 40:199/300 of query aligns to 14:162/490 of 6xohB
Sites not aligning to the query:
3kydB Human sumo e1~sumo1-amp tetrahedral intermediate mimic (see paper)
29% identity, 51% coverage: 40:192/300 of query aligns to 16:158/477 of 3kydB
Sites not aligning to the query:
>201587 FitnessBrowser__MR1:201587
MSATAQKSSSLNDKDFIRYSRQIFLPEVGEAGLLQLKQCHVVIIGCGGLGQLAAQYLACA
GIGSITLVDDDRVELSNLPRQLLFNEADIGQYKAWVAKQKLAVLAPDCQLFAFVQMLTLD
SAESLLAHVATANRQQSALLLDCTDNLAARHCINQLCIEHALPLVSASIAAFNGQLFAVD
QQRFPAGGCYHCVFPADTYAPQNCSNQGVLGPSVGVMASMQALLAIQLLLTATVPNLEHS
TKPQAVGAEHLLGRFWRFDAKSLQWHSARLTRDPECEVCAPSWNTNTDHVLKSVHKGELL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory