Comparing 201624 FitnessBrowser__MR1:201624 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A959 Glutamate-pyruvate aminotransferase AlaA; EC 2.6.1.2 from Escherichia coli (strain K12) (see paper)
70% identity, 100% coverage: 1:404/404 of query aligns to 1:404/405 of P0A959
4cvqA Crystal structure of an aminotransferase from escherichia coli at 2. 11 angstroem resolution (see paper)
70% identity, 100% coverage: 1:404/404 of query aligns to 1:404/404 of 4cvqA
1xi9C Alanine aminotransferase from pyrococcus furiosus pfu-1397077-001
39% identity, 98% coverage: 7:400/404 of query aligns to 3:391/393 of 1xi9C
Q93703 Tyrosine aminotransferase; TAT; L-tyrosine:2-oxoglutarate aminotransferase; EC 2.6.1.5 from Caenorhabditis elegans (see 3 papers)
27% identity, 90% coverage: 34:398/404 of query aligns to 75:437/464 of Q93703
3tcmA Crystal structure of alanine aminotransferase from hordeum vulgare (see paper)
27% identity, 96% coverage: 15:402/404 of query aligns to 17:474/479 of 3tcmA
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
28% identity, 99% coverage: 3:401/404 of query aligns to 18:384/384 of 1o4sB
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
28% identity, 91% coverage: 35:403/404 of query aligns to 27:386/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
28% identity, 91% coverage: 35:403/404 of query aligns to 27:386/388 of 1gd9A
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
28% identity, 94% coverage: 21:400/404 of query aligns to 21:396/402 of P14909
Sites not aligning to the query:
P04694 Tyrosine aminotransferase; TAT; L-tyrosine:2-oxoglutarate aminotransferase; EC 2.6.1.5 from Rattus norvegicus (Rat) (see 2 papers)
27% identity, 91% coverage: 35:402/404 of query aligns to 73:441/454 of P04694
Sites not aligning to the query:
3dydA Human tyrosine aminotransferase
27% identity, 91% coverage: 35:402/404 of query aligns to 17:385/388 of 3dydA
P17735 Tyrosine aminotransferase; TAT; L-tyrosine:2-oxoglutarate aminotransferase; EC 2.6.1.5 from Homo sapiens (Human) (see paper)
27% identity, 91% coverage: 35:402/404 of query aligns to 73:441/454 of P17735
6f77A Crystal structure of the prephenate aminotransferase from rhizobium meliloti (see paper)
27% identity, 87% coverage: 21:370/404 of query aligns to 18:368/399 of 6f77A
Q02635 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.79 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
27% identity, 87% coverage: 21:370/404 of query aligns to 19:369/400 of Q02635
Sites not aligning to the query:
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
27% identity, 97% coverage: 7:399/404 of query aligns to 5:382/382 of 1gc4A
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
27% identity, 97% coverage: 7:399/404 of query aligns to 5:382/382 of 1gc3A
Q9LR30 Glutamate--glyoxylate aminotransferase 1; AtGGT2; Alanine aminotransferase GGT1; Alanine--glyoxylate aminotransferase GGT1; Alanine-2-oxoglutarate aminotransferase 1; EC 2.6.1.4; EC 2.6.1.2; EC 2.6.1.44; EC 2.6.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 95% coverage: 15:398/404 of query aligns to 20:464/481 of Q9LR30
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
27% identity, 94% coverage: 21:399/404 of query aligns to 19:382/382 of 1b5oA
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
27% identity, 94% coverage: 21:399/404 of query aligns to 19:382/385 of Q56232
Sites not aligning to the query:
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
27% identity, 94% coverage: 21:399/404 of query aligns to 19:382/382 of 1bkgA
>201624 FitnessBrowser__MR1:201624
MRPIIKSNKLDTVCYDIRGPVHKEARRLEDEGHRILKLNIGNPAPFGFEAPEEIVRDVIL
NLPSAQGYCESKGLFSARKAIVQHYQAQGIYDVDIEDVYIGNGVSELIMMAMQGLLNTAD
EILIPSPDYPLWTAAANLAGGKAVHYRCDEEADWFPDLDDIKSKISSRTRGIVLINPNNP
TGAVYSKELLLQVVELCREHNLILFADEIYDKILYDEAKHIPAASLSDDILTVTFNGLSK
AYRAAGFRIGWMMLSGNLKAAKSYIEGLDMLASMRLCANVPNQHAIQTALGGYQSINELI
LPSGRLTVQRDTCYELLNQIPGVSVKKPKGALYAFPKLDMKKFNLRDDERLVLDLLRDKK
ILLVHGTAFNWPEPDHLRVVFLPYKEDLTKALTEFGNFLETYKQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory