Comparing 201703 FitnessBrowser__MR1:201703 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8ewoA Crystal structure of putative glyoxylase ii from pseudomonas aeruginosa
50% identity, 100% coverage: 1:267/267 of query aligns to 2:259/259 of 8ewoA
6rz0A Crystal structure of escherichia coli glyoxalase ii
41% identity, 100% coverage: 2:267/267 of query aligns to 1:251/251 of 6rz0A
Q8ZRM2 Hydroxyacylglutathione hydrolase; Glyoxalase II; Glx II; EC 3.1.2.6 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
39% identity, 100% coverage: 2:267/267 of query aligns to 1:251/251 of Q8ZRM2
2qedA Crystal structure of salmonella thyphimurium lt2 glyoxalase ii (see paper)
39% identity, 100% coverage: 2:267/267 of query aligns to 2:252/252 of 2qedA
Q9SID3 Hydroxyacylglutathione hydrolase 2, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
36% identity, 100% coverage: 2:267/267 of query aligns to 71:324/324 of Q9SID3
2q42A Ensemble refinement of the protein crystal structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 (see paper)
36% identity, 100% coverage: 2:267/267 of query aligns to 1:254/254 of 2q42A
1qh5B Human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl) glutathione (see paper)
35% identity, 100% coverage: 2:267/267 of query aligns to 1:255/260 of 1qh5B
1qh5A Human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl) glutathione (see paper)
35% identity, 100% coverage: 2:267/267 of query aligns to 1:255/260 of 1qh5A
1qh3A Human glyoxalase ii with cacodylate and acetate ions present in the active site (see paper)
35% identity, 100% coverage: 2:267/267 of query aligns to 1:255/260 of 1qh3A
Q16775 Hydroxyacylglutathione hydrolase, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Homo sapiens (Human) (see paper)
35% identity, 100% coverage: 2:267/267 of query aligns to 49:303/308 of Q16775
O24496 Hydroxyacylglutathione hydrolase cytoplasmic; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 89% coverage: 2:239/267 of query aligns to 1:237/258 of O24496
Sites not aligning to the query:
2p18A Crystal structure of the leishmania infantum glyoxalase ii (see paper)
30% identity, 90% coverage: 2:241/267 of query aligns to 13:270/283 of 2p18A
2zwrB Crystal structure of ttha1623 from thermus thermophilus hb8 (see paper)
31% identity, 79% coverage: 21:231/267 of query aligns to 19:203/207 of 2zwrB
2zziA Crystal structure of ttha1623 in a di-iron-bound form (see paper)
34% identity, 58% coverage: 21:176/267 of query aligns to 17:182/198 of 2zziA
4ysbA Crystal structure of ethe1 from myxococcus xanthus (see paper)
32% identity, 62% coverage: 14:178/267 of query aligns to 14:172/225 of 4ysbA
7ev5A Crystal structure of bleg-1 b3 metallo-beta-lactamase (see paper)
31% identity, 49% coverage: 16:147/267 of query aligns to 15:159/209 of 7ev5A
Sites not aligning to the query:
4yslA Crystal structure of sdoa from pseudomonas putida in complex with glutathione (see paper)
28% identity, 53% coverage: 37:178/267 of query aligns to 56:214/294 of 4yslA
Sites not aligning to the query:
4yskA Crystal structure of apo-form sdoa from pseudomonas putida (see paper)
28% identity, 53% coverage: 37:178/267 of query aligns to 56:214/294 of 4yskA
4ad9A Crystal structure of human lactb2. (see paper)
31% identity, 47% coverage: 51:176/267 of query aligns to 73:199/288 of 4ad9A
Q53H82 Endoribonuclease LACTB2; Beta-lactamase-like protein 2; EC 3.1.27.- from Homo sapiens (Human) (see paper)
31% identity, 47% coverage: 51:176/267 of query aligns to 73:199/288 of Q53H82
Sites not aligning to the query:
>201703 FitnessBrowser__MR1:201703
MLTITAINAFNDNYIWVLQQDTQQAVYVVDPGDVNVVLDYLNAHQLTLAGILITHHHRDH
TGGIAALVAYVEQTTGHTLAVYGPQSEAIQGVNIAIEPQITQILHLPFLNSPVQVLSVPG
HTAGHIAYLVDGALFCGDTLFSGGCGRLFEGTPAQMCHSLRLLAALPAETRVYCAHEYTL
ANLKFAQAADPSNAKLKAYNEQATALRAQGKATIPSTIGLERSINPFLRGLTPTIVDSIK
QQFCDQDLSNVDELTYFTLLRQWKDIF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory