Comparing 201976 FitnessBrowser__MR1:201976 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
8gxkB Pseudomonas jinjuensis n-acetyltransferase (see paper)
32% identity, 93% coverage: 6:186/194 of query aligns to 4:182/188 of 8gxkB
1yreB Hypothetical protein pa3270 from pseudomonas aeruginosa in complex with coa
38% identity, 69% coverage: 53:186/194 of query aligns to 51:182/187 of 1yreB
Sites not aligning to the query:
8gxfB Pseudomonas flexibilis gcn5 family acetyltransferase (see paper)
31% identity, 89% coverage: 15:186/194 of query aligns to 13:182/187 of 8gxfB
>201976 FitnessBrowser__MR1:201976
MGNDDLSACLNGEYIVLEPLSLSHVAALTDGELWRLWFTSVPEPSEMKAYVMKALAGKSR
GECFPFAVRDKVSGEIVGCTRICHWESEHRHLEIGYTWYAKRAQRTGINTDAKLLLLTFA
FETLEAIAVEFRTHWHNQASRQAIARLGAKQDRVLRNNKILKDGTIRDTVVYSIIDSEWV
TVKQHLLFRLQQYP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory