Comparing 202167 SO3048 isoquinoline 1-oxidoreductase, beta subunit, putative (NCBI ptt file) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
28% identity, 94% coverage: 37:742/748 of query aligns to 6:718/732 of 8gy3C
Q0QLF2 Nicotinate dehydrogenase large molybdopterin subunit; NDH; Nicotinic acid hydroxylase large molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see 2 papers)
25% identity, 35% coverage: 189:448/748 of query aligns to 3:285/425 of Q0QLF2
Sites not aligning to the query:
3hrdE Crystal structure of nicotinate dehydrogenase (see paper)
25% identity, 35% coverage: 189:448/748 of query aligns to 2:284/420 of 3hrdE
Sites not aligning to the query:
3hrdA Crystal structure of nicotinate dehydrogenase (see paper)
25% identity, 35% coverage: 189:448/748 of query aligns to 2:284/420 of 3hrdA
Sites not aligning to the query:
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
35% identity, 16% coverage: 623:743/748 of query aligns to 614:743/748 of 5y6qC
Sites not aligning to the query:
P77489 Aldehyde oxidoreductase molybdenum-binding subunit PaoC; EC 1.2.99.6 from Escherichia coli (strain K12) (see 2 papers)
31% identity, 15% coverage: 632:742/748 of query aligns to 601:719/732 of P77489
Sites not aligning to the query:
5g5gC Escherichia coli periplasmic aldehyde oxidase (see paper)
31% identity, 15% coverage: 632:743/748 of query aligns to 601:720/731 of 5g5gC
Sites not aligning to the query:
1rm6A Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
35% identity, 14% coverage: 641:743/748 of query aligns to 639:746/761 of 1rm6A
Sites not aligning to the query:
O33819 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.1.7.1 from Thauera aromatica (see paper)
35% identity, 14% coverage: 641:743/748 of query aligns to 647:754/769 of O33819
Sites not aligning to the query:
3hrdB Crystal structure of nicotinate dehydrogenase (see paper)
32% identity, 18% coverage: 605:742/748 of query aligns to 175:316/330 of 3hrdB
Sites not aligning to the query:
Q0QLF1 Nicotinate dehydrogenase medium molybdopterin subunit; NDH; Nicotinic acid hydroxylase medium molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
32% identity, 18% coverage: 605:742/748 of query aligns to 175:316/330 of Q0QLF1
Sites not aligning to the query:
4zohA Crystal structure of glyceraldehyde oxidoreductase (see paper)
32% identity, 16% coverage: 625:742/748 of query aligns to 571:695/701 of 4zohA
Sites not aligning to the query:
Q7G9P4 Abscisic-aldehyde oxidase; Aldehyde oxidase 3; AO-3; AtAO-3; AtAO4; Indole-3-acetaldehyde oxidase; IAA oxidase; EC 1.2.3.14; EC 1.2.3.7 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 19% coverage: 324:462/748 of query aligns to 718:861/1332 of Q7G9P4
1t3qB Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
29% identity, 33% coverage: 367:611/748 of query aligns to 219:462/786 of 1t3qB
Sites not aligning to the query:
2e3tA Crystal structure of rat xanthine oxidoreductase mutant (w335a and f336l) (see paper)
26% identity, 33% coverage: 202:447/748 of query aligns to 556:818/1291 of 2e3tA
Sites not aligning to the query:
6a7xB Rat xanthine oxidoreductase, d428a variant, NAD bound form
26% identity, 33% coverage: 202:447/748 of query aligns to 554:816/1291 of 6a7xB
Sites not aligning to the query:
4yswA Structure of rat xanthine oxidoreductase, c-terminal deletion protein variant, nadh bound form (see paper)
26% identity, 33% coverage: 202:447/748 of query aligns to 554:816/1286 of 4yswA
Sites not aligning to the query:
6a7xA Rat xanthine oxidoreductase, d428a variant, NAD bound form
26% identity, 33% coverage: 202:447/748 of query aligns to 556:818/1295 of 6a7xA
Sites not aligning to the query:
P22985 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Rattus norvegicus (Rat) (see 2 papers)
26% identity, 33% coverage: 202:447/748 of query aligns to 583:845/1331 of P22985
Sites not aligning to the query:
Q8GUQ8 Xanthine dehydrogenase 1; AtXDH1; EC 1.17.1.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
24% identity, 37% coverage: 186:462/748 of query aligns to 590:888/1361 of Q8GUQ8
Sites not aligning to the query:
>202167 SO3048 isoquinoline 1-oxidoreductase, beta subunit, putative (NCBI ptt file)
MSTFTAVENISRRDVLKLFGAVGGGLALGASGLSWSPMALAQDQQARLNLFIAIGEDDKV
YLTCHRSEMGQGIRTGILQILAEELEADWDKIVPIQGLADKRYASQNTDGSRSIRENYDR
MREMGAMARTMLEQAAAARWKVPVTEVQAKDHKVMHAKSGRSARFGELALDAAALPLPAA
DSLRLKAVKDFKQIGASRQIVDMQAMLTGKAVYGYDIQVDNMLYASIVRPPVLGSDVASL
DDTAARKVQGVVDVYRLPTPKGAPAFQALGGVAVVATNTWSALQGRKALKVTWTQSANSS
HDSKTYLQELVDKVQAPGKVVRQVGDEVKAWPEANTLKAIYTVPYLIHSSIEPPVATANV
TEKGCEIWASTQTPQSTQQNVAAALGIAEDAVKVNVTLLGGGFGRKSKPDFSVEAALLSK
QLKRPVKVSWSREDEIQNGYYHAISAQCYQALFDTNNQPTALLARTGFPSISSTFAEGVE
YPSDGELDLGFVDVPFALPHLRYEAVKATAHSRIGWMRSVCNIQHGFGVGSFVDEMAHKA
QLSCPDMWRSLLGQPRRETFDNQGFKYGNYGEELTRHPVDIGRYLKVIEAVEQAQAKAPK
AGKNQGWGFAVHRSFVSVVAVAMRVEVSEDKQLKVLNAIAAIDAGTVVNPDRVKAQTEGA
IVFGLSLALMGEISYQEGKVVQSNFHDYPLLRLPQVPEIEIIIIDSDAPPAGVGEPGVPP
VAPSLTNAIFAATGVRIRDLPVNKQLKV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory