SitesBLAST
Comparing 202262 FitnessBrowser__MR1:202262 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3vbkC Crystal structure of the s84a mutant of antd, an n-acyltransferase from bacillus cereus in complex with dtdp-4-amino-4,6-dideoxyglucose and coenzyme a (see paper)
31% identity, 78% coverage: 46:209/209 of query aligns to 7:174/186 of 3vbkC
- binding dTDP-4-amino-4,6-dideoxyglucose: Y31 (≠ F70), R43 (≠ M84), D45 (≠ A86), D46 (≠ A87), S51 (≠ H92), H61 (≠ A102), A92 (≠ F133)
- binding bicarbonate ion: H61 (≠ A102), I83 (= I124)
- binding coenzyme a: Y90 (= Y131), I93 (vs. gap), F96 (vs. gap), F133 (≠ V168), G145 (= G180), A146 (≠ M181), M149 (≠ I184), K151 (≠ T186), V161 (≠ A196), V163 (≠ N198)
Sites not aligning to the query:
3vbjA Crystal structure of antd, an n-acyltransferase from bacillus cereus in complex with dtdp and 3-hydroxybutyryl-coa (see paper)
30% identity, 78% coverage: 46:209/209 of query aligns to 7:174/186 of 3vbjA
- binding 3-hydroxybutanoyl-coenzyme a: H61 (≠ A102), I83 (= I124), S84 (≠ A125), Y90 (= Y131), D94 (vs. gap), F96 (vs. gap), F133 (≠ V168), G145 (= G180), A146 (≠ M181), K151 (≠ T186), V161 (≠ A196), V163 (≠ N198), K169 (≠ G204)
- binding thymidine-5'-diphosphate: Y31 (≠ F70), R43 (≠ M84), D45 (≠ A86), D46 (≠ A87), S51 (≠ H92)
Sites not aligning to the query:
3vbiA Crystal structure of antd, an n-acyltransferase from bacillus cereus in complex with dtdp-4-amino-4,6-dideoxyglucose and coenzyme a (see paper)
30% identity, 78% coverage: 46:209/209 of query aligns to 7:174/186 of 3vbiA
- binding dTDP-4-amino-4,6-dideoxyglucose: Y31 (≠ F70), R43 (≠ M84), D45 (≠ A86), D46 (≠ A87), S51 (≠ H92), H61 (≠ A102), Y69 (≠ D110), A92 (≠ F133), D94 (vs. gap)
- binding coenzyme a: S84 (≠ A125), Y90 (= Y131), I93 (vs. gap), F96 (vs. gap), F133 (≠ V168), G145 (= G180), A146 (≠ M181), K151 (≠ T186), V161 (≠ A196), V163 (≠ N198), K169 (≠ G204)
Sites not aligning to the query:
3vbmE Crystal structure of the s84t mutant of antd, an n-acyltransferase from bacillus cereus in complex with dtdp and coenzyme a (see paper)
30% identity, 78% coverage: 46:209/209 of query aligns to 14:181/193 of 3vbmE
- binding coenzyme a: T91 (≠ A125), Y97 (= Y131), I100 (vs. gap), F103 (vs. gap), G134 (= G162), F140 (≠ V168), G152 (= G180), A153 (≠ M181), K158 (≠ T186), V168 (≠ A196), V170 (≠ N198), P171 (= P199), K176 (≠ G204)
- binding thymidine-5'-diphosphate: Y38 (≠ F70), R50 (≠ M84), D52 (≠ A86), D53 (≠ A87), S58 (≠ H92)
Sites not aligning to the query:
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
28% identity, 92% coverage: 17:209/209 of query aligns to 23:187/201 of 1krvA
- binding 4-nitrophenyl beta-D-galactopyranoside: R25 (= R19), S70 (≠ N78), Y82 (≠ F90), N84 (≠ H92), V90 (≠ G98), D92 (≠ E100), M126 (vs. gap)
- binding coenzyme a: A104 (= A125), S110 (≠ Y131), T112 (≠ F133), W138 (= W160), G140 (= G162), S141 (≠ A163), N146 (≠ V168), A159 (≠ M181), P177 (= P199), R179 (= R201), R182 (≠ G204)
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
28% identity, 92% coverage: 17:209/209 of query aligns to 23:187/201 of 1kruA
- binding coenzyme a: H114 (= H135), W138 (= W160), G140 (= G162), S141 (≠ A163), G158 (= G180), A159 (≠ M181), P177 (= P199), R182 (≠ G204)
- binding 1-methylethyl 1-thio-beta-D-galactopyranoside: R25 (= R19), W62 (≠ F62), S70 (≠ N78), Y82 (≠ F90), Y82 (≠ F90), N84 (≠ H92), V90 (≠ G98), D92 (≠ E100), L102 (≠ R123), H114 (= H135), M126 (vs. gap)
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
28% identity, 92% coverage: 17:209/209 of query aligns to 23:187/200 of 1krrA
- binding acetyl coenzyme *a: N84 (≠ H92), I103 (= I124), A104 (= A125), P105 (≠ N126), T112 (≠ F133), H114 (= H135), G140 (= G162), S141 (≠ A163), N146 (≠ V168), G158 (= G180), A159 (≠ M181), A174 (= A196), P177 (= P199), R182 (≠ G204)
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
28% identity, 92% coverage: 17:209/209 of query aligns to 24:188/203 of P07464
- S71 (≠ N78) binding
- N85 (≠ H92) binding in other chain; binding in other chain
- D93 (≠ E100) binding
- H115 (= H135) mutation to A: Results in an 1800-fold decrease in catalytic activity.
- S142 (≠ A163) binding in other chain
- A160 (≠ M181) binding in other chain
- TK 165:166 (= TK 186:187) binding
- R180 (= R201) binding
- R183 (≠ G204) binding in other chain
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed; Partial
- 17 binding
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
37% identity, 65% coverage: 68:203/209 of query aligns to 52:181/186 of 4isxA
Sites not aligning to the query:
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
44% identity, 42% coverage: 116:203/209 of query aligns to 97:183/188 of 3igjC
Sites not aligning to the query:
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
29% identity, 83% coverage: 30:203/209 of query aligns to 1:181/190 of 5u2kA
A1ADJ6 Polysialic acid O-acetyltransferase; Capsule O-acetyl transferase; EC 2.3.1.136 from Escherichia coli O1:K1 / APEC (see paper)
31% identity, 65% coverage: 69:203/209 of query aligns to 141:277/307 of A1ADJ6
- H210 (≠ G136) mutation to A: Loss of activity.
- W234 (= W160) mutation to A: Loss of activity.
4mzuF Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
34% identity, 60% coverage: 79:204/209 of query aligns to 31:142/294 of 4mzuF
- binding coenzyme a: N81 (≠ H135), D82 (≠ G136), K83 (≠ M137), G100 (= G162), A101 (= A163), L106 (≠ V168), G118 (= G180), A119 (≠ M181), T124 (= T186), K125 (= K187), I134 (≠ A196), N136 (= N198), R139 (= R201)
- binding thymine: C38 (≠ A86)
Sites not aligning to the query:
4mzuB Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
34% identity, 60% coverage: 79:204/209 of query aligns to 31:141/290 of 4mzuB
- binding coenzyme a: F72 (≠ R123), T80 (≠ N134), N81 (≠ H135), D82 (≠ G136), K83 (≠ M137), P85 (= P139), G99 (= G162), A100 (= A163), G117 (= G180), A118 (≠ M181), T123 (= T186), K124 (= K187), I133 (≠ A196), R138 (= R201)
- binding magnesium ion: G58 (= G106), N76 (≠ H127)
- binding thymine: C38 (≠ A86), A39 (= A87)
Sites not aligning to the query:
4hurA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with acetyl coenzyme a (see paper)
33% identity, 57% coverage: 88:206/209 of query aligns to 47:166/211 of 4hurA
- binding acetyl coenzyme *a: Y51 (≠ H92), S67 (= S108), I68 (≠ L109), G69 (≠ D110), A79 (≠ D120), N80 (≠ Q121), K110 (≠ S150), W120 (= W160), I121 (= I161), G122 (= G162), R123 (≠ A163), M128 (≠ V168), A140 (≠ G180), A141 (≠ M181), T146 (= T186), G156 (≠ A196), P159 (= P199), I163 (= I203), R164 (≠ G204)
4husA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with virginiamycin m1 (see paper)
33% identity, 57% coverage: 88:206/209 of query aligns to 47:166/212 of 4husA
Sites not aligning to the query:
6x3cA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
33% identity, 57% coverage: 88:206/209 of query aligns to 47:166/207 of 6x3cA
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: Y53 (≠ P94), G78 (= G119), N80 (≠ Q121), H81 (≠ T122), H91 (≠ Y131), L92 (≠ A132), M101 (≠ T141), P102 (= P142), L104 (≠ Y144)
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: Y51 (≠ H92), G69 (≠ D110), N80 (≠ Q121), H81 (≠ T122), W120 (= W160), G122 (= G162), R123 (≠ A163), M128 (≠ V168), A140 (≠ G180), A141 (≠ M181)
Sites not aligning to the query:
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: 17, 36
6x3jA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f0224 (46) (see paper)
33% identity, 57% coverage: 88:206/209 of query aligns to 47:166/206 of 6x3jA
- binding (2R)-2-[(3S,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-4,12-dimethyl-1,7,22-trioxo-4,7,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,3H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosin-3-yl]propyl isoquinolin-3-ylcarbamate: Y51 (≠ H92), Y53 (≠ P94), V55 (≠ T96), H91 (≠ Y131), L92 (≠ A132), M101 (≠ T141), P102 (= P142), L107 (≠ A147)
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: G69 (≠ D110), A79 (≠ D120), H81 (≠ T122), W120 (= W160), G122 (= G162)
6x3cE Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
33% identity, 57% coverage: 88:206/209 of query aligns to 47:166/203 of 6x3cE
- binding magnesium ion: N158 (= N198), P159 (= P199)
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: Y53 (≠ P94), G78 (= G119), N80 (≠ Q121), H81 (≠ T122), H91 (≠ Y131), L92 (≠ A132), M101 (≠ T141), P102 (= P142)
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: Y51 (≠ H92), G69 (≠ D110), H81 (≠ T122), M83 (≠ I124), W120 (= W160), G122 (= G162), A140 (≠ G180), A141 (≠ M181)
6pubA Crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with crystal violet
31% identity, 68% coverage: 65:206/209 of query aligns to 15:165/210 of 6pubA
Sites not aligning to the query:
Query Sequence
>202262 FitnessBrowser__MR1:202262
MHTPITTALPDYQSQHKKRLSWMPWLYFSLKEKHLTWAKPWQNEVQTNLCALETVTIGDN
CFIAPEAQLFAEPNRDINIGNHCMIAADCFLHGPITLGNEVAINHGCSLDGGRVGIQIGD
QTRIANHVTIYAFNHGMAPDTPIYQQASHSKGIVIGKDVWIGAQAGIVDGVTIGDHAVIG
MGCIVTKDVPAWAIVAGNPARVIGDRRDK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory