Comparing 202296 FitnessBrowser__MR1:202296 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1mc3A Crystal structure of rffh (see paper)
73% identity, 95% coverage: 14:303/304 of query aligns to 1:290/291 of 1mc3A
P61887 Glucose-1-phosphate thymidylyltransferase 2; G1P-TT 2; dTDP-glucose pyrophosphorylase 2; dTDP-glucose synthase 2; EC 2.7.7.24 from Escherichia coli (strain K12) (see paper)
74% identity, 95% coverage: 16:303/304 of query aligns to 2:289/293 of P61887
4ho9A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-galactose and utp
72% identity, 95% coverage: 16:304/304 of query aligns to 2:290/294 of 4ho9A
4ho4A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with thymidine and glucose-1-phosphate
72% identity, 94% coverage: 16:301/304 of query aligns to 2:287/289 of 4ho4A
4ho6A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-glucose and utp
73% identity, 93% coverage: 16:299/304 of query aligns to 2:285/288 of 4ho6A
4ho5A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with tdp-glucose
73% identity, 93% coverage: 16:299/304 of query aligns to 2:285/288 of 4ho5A
4ho3A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with thymidine triphosphate
73% identity, 93% coverage: 16:299/304 of query aligns to 2:285/288 of 4ho3A
4hocA Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-n- acetylglucosamine
73% identity, 93% coverage: 16:299/304 of query aligns to 2:283/286 of 4hocA
3zllA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
68% identity, 93% coverage: 13:296/304 of query aligns to 5:288/297 of 3zllA
3zlkA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
68% identity, 93% coverage: 13:296/304 of query aligns to 5:288/297 of 3zlkA
5fyeA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
68% identity, 93% coverage: 13:296/304 of query aligns to 4:287/296 of 5fyeA
5fu0A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
68% identity, 93% coverage: 13:296/304 of query aligns to 4:287/296 of 5fu0A
5ftvA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
68% identity, 93% coverage: 13:296/304 of query aligns to 4:287/296 of 5ftvA
5ftsA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
68% identity, 93% coverage: 13:296/304 of query aligns to 4:287/296 of 5ftsA
4arwA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
68% identity, 93% coverage: 13:296/304 of query aligns to 2:285/294 of 4arwA
P26393 Glucose-1-phosphate thymidylyltransferase; dTDP-glucose pyrophosphorylase; Ep; dTDP-glucose synthase; EC 2.7.7.24 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
65% identity, 94% coverage: 16:301/304 of query aligns to 5:290/292 of P26393
4b2xB Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
66% identity, 96% coverage: 4:296/304 of query aligns to 1:293/302 of 4b2xB
5fuhA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
66% identity, 96% coverage: 6:296/304 of query aligns to 2:289/298 of 5fuhA
4b4bA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
66% identity, 96% coverage: 6:296/304 of query aligns to 2:289/298 of 4b4bA
1iinA Thymidylyltransferase complexed with udp-glucose (see paper)
65% identity, 94% coverage: 16:300/304 of query aligns to 5:289/289 of 1iinA
>202296 FitnessBrowser__MR1:202296
MELNTQHSTLKTHNTKGIILAGGSGTRLYPITKGVSKQLLPVYDKPMIYYPISVLMLAGI
RDILIITTPEDQSSFQRLLGDGSDFGISLQYAVQVTPDGLAQAFIIGEEFIGNDNVCLAL
GDNIFWGQGFSPILKKAAARPTGASVFGYQVKDPERFGVVEFDQDLKAISIEEKPLKPKS
NFAVTGLYFYDNRVVNIAKNVKPSERGELEITSINQAYLEMGKLNVELLGRGFAWLDTGT
YESLLEAASFVETIEKRQGYKIACLEEIAWRNHWLSNEQILKVANEMSKNSYGQYLLGLV
EIKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory