Comparing 202520 FitnessBrowser__MR1:202520 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
1vb3A Crystal structure of threonine synthase from escherichia coli
59% identity, 98% coverage: 1:419/427 of query aligns to 1:421/428 of 1vb3A
4f4fA X-ray crystal structure of plp bound threonine synthase from brucella melitensis
35% identity, 93% coverage: 1:395/427 of query aligns to 2:431/464 of 4f4fA
Q42598 Threonine synthase; TS; EC 4.2.3.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
33% identity, 89% coverage: 10:389/427 of query aligns to 14:464/514 of Q42598
1kl7A Crystal structure of threonine synthase from yeast (see paper)
33% identity, 89% coverage: 11:389/427 of query aligns to 16:461/509 of 1kl7A
8g1yA Crystal structure of the threonine synthase from streptococcus pneumoniae in complex with pyridoxal 5-phosphate.
34% identity, 82% coverage: 7:357/427 of query aligns to 11:387/496 of 8g1yA
Sites not aligning to the query:
2c2bA Crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine (see paper)
27% identity, 66% coverage: 101:380/427 of query aligns to 124:403/444 of 2c2bA
Sites not aligning to the query:
Q9S7B5 Threonine synthase 1, chloroplastic; Protein METHIONINE OVER-ACCUMULATOR 2; EC 4.2.3.1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
27% identity, 66% coverage: 101:380/427 of query aligns to 199:478/526 of Q9S7B5
Sites not aligning to the query:
2c2gA Crystal structure of threonine synthase from arabidopsis thaliana in complex with its cofactor pyridoxal phosphate (see paper)
26% identity, 66% coverage: 101:380/427 of query aligns to 142:405/448 of 2c2gA
6nmxA Threonine synthase from bacillus subtilis atcc 6633 with plp and appa (see paper)
31% identity, 36% coverage: 100:253/427 of query aligns to 55:193/350 of 6nmxA
Sites not aligning to the query:
6cgqB Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
31% identity, 36% coverage: 100:253/427 of query aligns to 53:191/345 of 6cgqB
Sites not aligning to the query:
P9WG59 Threonine synthase; TS; EC 4.2.3.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
26% identity, 49% coverage: 100:307/427 of query aligns to 64:258/360 of P9WG59
Sites not aligning to the query:
2d1fA Structure of mycobacterium tuberculosis threonine synthase (see paper)
26% identity, 49% coverage: 100:307/427 of query aligns to 55:249/349 of 2d1fA
Sites not aligning to the query:
6cgqA Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
28% identity, 36% coverage: 100:253/427 of query aligns to 51:183/339 of 6cgqA
Sites not aligning to the query:
>202520 FitnessBrowser__MR1:202520
MELYNLKHPSQTVSFKEAVQLGLGKDRGLFFPTQIPVLHDIEALLAMPFVERSKKVLGAW
LASELGQDMVDQLVERAFNFDLPLVAVDEQRACLELFHGPTLAFKDFGARFMAQCINVFA
QDSRLTILTATSGDTGAAVADAFYGLEKVNVVVLYPKGKISELQEKMFTTLGKNIHTVAV
ASDFDACQHLVKQAFEDSDVRDGLHLNSANSINISRLLAQICYYFEAVAQSKQRHEADPV
IAVPSGNFGNLTAGLFAKAMGLPVKRFIAATNANDTVPRYLDSGHWQPNPTQATMSNAMD
VSEPSNWPRVEAICEKLGWPLADLVGICLSEAQTSEALVDLYAKGYVSEPHAAIAAKALT
LNLVPDEVGIFLGTAHPAKFKDVVDRELALNLPLPPELKAVAHKPILSAELAADFAQLKA
HLFAVLS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory