Comparing 202770 FitnessBrowser__MR1:202770 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 94% coverage: 18:272/272 of query aligns to 10:263/265 of P07821
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
32% identity, 82% coverage: 22:243/272 of query aligns to 4:222/240 of 4ymuJ
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
32% identity, 78% coverage: 26:238/272 of query aligns to 10:226/232 of 1f3oA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 78% coverage: 35:246/272 of query aligns to 21:230/343 of P30750
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
33% identity, 78% coverage: 34:246/272 of query aligns to 17:225/241 of 4u00A
Sites not aligning to the query:
5x40A Structure of a cbio dimer bound with amppcp (see paper)
34% identity, 83% coverage: 20:246/272 of query aligns to 5:229/280 of 5x40A
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
32% identity, 78% coverage: 26:238/272 of query aligns to 10:226/230 of 1l2tA
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
32% identity, 78% coverage: 35:246/272 of query aligns to 22:231/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
32% identity, 78% coverage: 35:246/272 of query aligns to 22:231/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
32% identity, 78% coverage: 35:246/272 of query aligns to 22:231/344 of 3tuiC
Sites not aligning to the query:
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
26% identity, 86% coverage: 20:254/272 of query aligns to 3:233/240 of 6mjpA
3nhaA Nucleotide binding domain of human abcb6 (adp mg bound structure) (see paper)
31% identity, 86% coverage: 14:246/272 of query aligns to 35:263/278 of 3nhaA
3c4jA Abc protein artp in complex with atp-gamma-s
32% identity, 82% coverage: 20:243/272 of query aligns to 4:224/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
32% identity, 82% coverage: 20:243/272 of query aligns to 4:224/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
32% identity, 82% coverage: 20:243/272 of query aligns to 4:224/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
32% identity, 82% coverage: 20:243/272 of query aligns to 4:224/242 of 2oljA
8bmsA Cryo-em structure of the mutant solitary ecf module 2eq in msp2n2 lipid nanodiscs in the atpase closed and atp-bound conformation (see paper)
30% identity, 82% coverage: 20:243/272 of query aligns to 5:226/278 of 8bmsA
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
30% identity, 82% coverage: 23:246/272 of query aligns to 14:226/276 of Q5M243
5d3mA Folate ecf transporter: amppnp bound state (see paper)
30% identity, 82% coverage: 20:243/272 of query aligns to 6:229/280 of 5d3mA
8bmpA Cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp (see paper)
32% identity, 77% coverage: 35:243/272 of query aligns to 20:226/278 of 8bmpA
Sites not aligning to the query:
>202770 FitnessBrowser__MR1:202770
MAMSLSAAPVAKQHFERTQLTVDRLSYAIGDKAVLNNIRVQFQPGSVTALLGPNGAGKST
LLKALCQEIPSAQGSIKLGHCQLVDWPRAELAKSLAVLPQHASLTFPFTVDEVVAMGLYP
LTLSQKEGQQLVTKWLAEVGVLHLARRSYPTLSGGEKQRVQLARVLTQLSQSPFPPILLL
DEPTSALDLAQQHKVLALAKNLAHKHAYTVIVVLHDLNQAARYSDRVIVLKQGEIVSEGT
PNDALSIDIIRQVWDYEPEFIPAPQGDYPLIF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory