Comparing 202773 FitnessBrowser__MR1:202773 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
24% identity, 50% coverage: 29:271/489 of query aligns to 6:236/824 of 4pabB
Sites not aligning to the query:
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
24% identity, 50% coverage: 29:271/489 of query aligns to 43:273/857 of Q63342
Sites not aligning to the query:
2gagB Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
21% identity, 72% coverage: 30:380/489 of query aligns to 21:335/403 of 2gagB
Sites not aligning to the query:
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
25% identity, 54% coverage: 45:307/489 of query aligns to 21:259/364 of 3if9A
Sites not aligning to the query:
>202773 FitnessBrowser__MR1:202773
MKERGFWFDTEAKLTQRTILPALQHDIAADIAIIGAGYSGLWTAYYLKQYQPNLSVAILE
ADTIGQGASGRNGGWLMGSFSGDVAYLNQLQGESRLMAKALIQQIIAEVAAVCAKHHIDC
DLHHGGNLRVAARYPEQLANIQAELAQWRRQGFGEADIRWLDKTELDKQVSMAHGQAALY
TPHCARIHPAKLVCGLADVVQNLGVKIFEQTPVTHIEHWGAAQTRLHTPKGSARAAIVVP
AVEGYLRQLGELGRFTLPVQSLLIATEPLTDEMWQDIGLANRATFSDASRIVTYGQRSPD
NRLIFGARGGYGFGAKVRTEFGFNRECFNAQSPASDPQSALKGEFGFRYQLLLALFPQLA
DVQITHGWGGTLALARQFAPHAIYDKNVGLGLIGGYGGEGVGAANLFARTLVDLILARDT
PLTTMPWAFNAPIQQVLTPWEPEPLPWLAYHGMNKIFAWEDRLYSRPKSAAWQKGLAKRL
ANKLEGLMS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory