Comparing 202786 FitnessBrowser__MR1:202786 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
50% identity, 89% coverage: 1:219/246 of query aligns to 3:221/226 of 5xu1B
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
48% identity, 89% coverage: 1:218/246 of query aligns to 1:223/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
48% identity, 89% coverage: 1:218/246 of query aligns to 1:223/230 of 1l2tA
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
46% identity, 89% coverage: 1:219/246 of query aligns to 3:217/223 of 2pclA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
41% identity, 98% coverage: 1:241/246 of query aligns to 3:245/592 of 5lj7A
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
41% identity, 98% coverage: 1:241/246 of query aligns to 3:245/615 of 5lilA
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
42% identity, 89% coverage: 1:219/246 of query aligns to 4:222/648 of P75831
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
43% identity, 93% coverage: 1:228/246 of query aligns to 4:228/650 of 5ws4A
7mdyC Lolcde nucleotide-bound
43% identity, 89% coverage: 1:218/246 of query aligns to 2:220/226 of 7mdyC
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
43% identity, 89% coverage: 1:218/246 of query aligns to 5:223/233 of P75957
7arlD Lolcde in complex with lipoprotein and adp (see paper)
43% identity, 89% coverage: 1:218/246 of query aligns to 2:220/222 of 7arlD
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
42% identity, 89% coverage: 1:218/246 of query aligns to 4:222/229 of 7v8iD
8g4cB Bceabs atpgs high res tm (see paper)
38% identity, 89% coverage: 1:218/246 of query aligns to 3:221/248 of 8g4cB
7tchB Bceab e169q variant atp-bound conformation (see paper)
37% identity, 89% coverage: 1:218/246 of query aligns to 2:220/245 of 7tchB
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
38% identity, 88% coverage: 1:216/246 of query aligns to 2:211/241 of 4u00A
8iddA Cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc (see paper)
43% identity, 81% coverage: 1:200/246 of query aligns to 2:198/225 of 8iddA
A5U7B7 Cell division ATP-binding protein FtsE from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) (see 2 papers)
43% identity, 81% coverage: 1:200/246 of query aligns to 1:197/229 of A5U7B7
8igqA Cryo-em structure of mycobacterium tuberculosis adp bound ftsex/ripc complex in peptidisc (see paper)
43% identity, 81% coverage: 1:200/246 of query aligns to 2:198/227 of 8igqA
3c4jA Abc protein artp in complex with atp-gamma-s
39% identity, 88% coverage: 1:216/246 of query aligns to 3:213/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
39% identity, 88% coverage: 1:216/246 of query aligns to 3:213/242 of 3c41J
>202786 FitnessBrowser__MR1:202786
MLSMKNISKVFKTDLVETHALRDFNLEVSEGEFVAVTGPSGSGKTTFLNIAGLLEGFTHG
DYFLDGINVSNLSDNKSAAVRNEKIGFIFQGFNLIPDLNLAENIEVPLRYRGFSAKERNR
RVEQALEQVGLAARMKHLPTQLSGGQQQRVAIARALAGEPRFLLADEPTGNLDSLMARQV
MELLENINQAGTTIIMVTHDPELARRAQRNIQIVDGQVCDFTMYQPNVARSASLGSVDKL
VANAQG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory