Comparing 202808 FitnessBrowser__MR1:202808 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
27% identity, 92% coverage: 24:333/336 of query aligns to 2:295/313 of 2h3hA
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
26% identity, 92% coverage: 24:333/336 of query aligns to 2:295/305 of 3c6qC
5hqjA Crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose
29% identity, 93% coverage: 22:332/336 of query aligns to 5:289/289 of 5hqjA
6guqA Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with glucose
25% identity, 77% coverage: 47:306/336 of query aligns to 25:255/278 of 6guqA
Sites not aligning to the query:
5dkvA Crystal structure of an abc transporter solute binding protein from agrobacterium vitis(avis_5339, target efi-511225) bound with alpha-d- tagatopyranose
24% identity, 92% coverage: 18:326/336 of query aligns to 1:290/303 of 5dkvA
6gt9A Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with galactose
25% identity, 77% coverage: 47:306/336 of query aligns to 30:260/283 of 6gt9A
Sites not aligning to the query:
3t95A Crystal structure of lsrb from yersinia pestis complexed with autoinducer-2 (see paper)
37% identity, 27% coverage: 25:115/336 of query aligns to 3:92/314 of 3t95A
Sites not aligning to the query:
1tjyA Crystal structure of salmonella typhimurium ai-2 receptor lsrb in complex with r-thmf (see paper)
35% identity, 28% coverage: 21:115/336 of query aligns to 1:94/316 of 1tjyA
Sites not aligning to the query:
4wutA Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
22% identity, 91% coverage: 28:333/336 of query aligns to 6:286/290 of 4wutA
4pz0A The crystal structure of a solute binding protein from bacillus anthracis str. Ames in complex with quorum-sensing signal autoinducer-2 (ai-2)
34% identity, 28% coverage: 23:117/336 of query aligns to 7:100/321 of 4pz0A
Sites not aligning to the query:
3ejwA Crystal structure of the sinorhizobium meliloti ai-2 receptor, smlsrb (see paper)
31% identity, 32% coverage: 23:129/336 of query aligns to 1:102/315 of 3ejwA
Sites not aligning to the query:
4rxmB Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
22% identity, 80% coverage: 23:291/336 of query aligns to 3:243/288 of 4rxmB
4rxmA Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
22% identity, 80% coverage: 23:291/336 of query aligns to 5:245/291 of 4rxmA
Sites not aligning to the query:
7x0hA Crystal structure of sugar binding protein cbpa complexed wtih glucose from clostridium thermocellum (see paper)
35% identity, 31% coverage: 48:150/336 of query aligns to 32:126/287 of 7x0hA
Sites not aligning to the query:
4wzzA Crystal structure of an abc transporter solute binding protein (ipr025997) from clostridium phytofermentas (cphy_0583, target efi- 511148) with bound l-rhamnose
22% identity, 49% coverage: 20:185/336 of query aligns to 1:159/321 of 4wzzA
Sites not aligning to the query:
5xssA Xylfii molecule (see paper)
30% identity, 35% coverage: 48:163/336 of query aligns to 28:136/274 of 5xssA
Sites not aligning to the query:
4wt7A Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5165, target efi-511223) with bound allitol
23% identity, 72% coverage: 94:335/336 of query aligns to 76:294/294 of 4wt7A
Sites not aligning to the query:
>202808 FitnessBrowser__MR1:202808
MARLLMLIIALGLLPISSVYGKELKLALVPKFYSVFFDQSKNGCIDAAAQIEGVECIYRG
PEISSVRLQDQVINQLIDEGVDGIAVAVTQSKYLVENSLKRAKEVGIPIVTYDSDFDASI
NGDPKNFRLAYIGTDNFELGKSLGEELKKLRPNGGMLIMQSGRPDSPNLNLRLMGVRSAL
SGKKYDIPPGKLLNNEQGWTEVREPLFNFDQLSQAVKQMESVMKGKPVKADSFIAVGGWA
QNNDALYRDMIAPFQEKINDKEVVIVMTDTSPEQLTMLKDNLAHINVGQNPYEMGRQAIL
TLYKIVTKQQYEEVIYTPVTFCTPQNFNTCEKRAGM
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory