SitesBLAST
Comparing 202993 FitnessBrowser__MR1:202993 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7borA Structure of pseudomonas aeruginosa coa-bound odaa (see paper)
40% identity, 99% coverage: 4:245/245 of query aligns to 4:247/247 of 7borA
- active site: N63 (= N63), F68 (= F68), D77 (≠ N77), G81 (≠ V81), I105 (= I105), T108 (= T108), F128 (= F128), L133 (= L133), P135 (= P135), E136 (= E136), A222 (≠ H220), L232 (= L230)
- binding coenzyme a: D21 (= D21), K22 (= K22), A25 (= A25), S61 (= S61), I65 (≠ V65), V103 (= V103), F128 (= F128), L131 (= L131), F244 (= F242), R247 (≠ K245)
6slbAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
39% identity, 81% coverage: 11:208/245 of query aligns to 12:211/257 of 6slbAAA
- active site: Q64 (≠ N63), F69 (= F68), L80 (vs. gap), N84 (≠ V81), A108 (≠ I105), S111 (≠ T108), A130 (≠ P127), F131 (= F128), L136 (= L133), P138 (= P135), D139 (≠ E136)
- binding (~{E})-6-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-6-oxidanylidene-hex-3-enoic acid: R58 (≠ N57), A62 (≠ S61), Q64 (≠ N63), D65 (= D64), L66 (≠ V65), Y76 (≠ H78), A108 (≠ I105), F131 (= F128), D139 (≠ E136)
Sites not aligning to the query:
6slaAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
38% identity, 84% coverage: 4:208/245 of query aligns to 3:199/245 of 6slaAAA
- active site: Q61 (≠ N63), L68 (= L69), N72 (≠ D73), A96 (≠ I105), S99 (≠ T108), A118 (≠ P127), F119 (= F128), L124 (= L133), P126 (= P135), N127 (≠ E136)
- binding ~{S}-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyl] 2-(2,5-dihydrooxepin-7-yl)ethanethioate: L21 (≠ R23), A59 (≠ S61), Q61 (≠ N63), D62 (= D64), L63 (≠ V65), L68 (= L69), Y71 (≠ S72), A94 (≠ V103), G95 (= G104), A96 (≠ I105), F119 (= F128), I122 (≠ L131), L124 (= L133), N127 (≠ E136)
Sites not aligning to the query:
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
28% identity, 99% coverage: 4:245/245 of query aligns to 6:249/255 of 3q0jC
- active site: A65 (≠ N63), M70 (≠ F68), T80 (≠ V81), F84 (= F85), G108 (≠ I105), E111 (≠ T108), P130 (= P127), E131 (≠ F128), V136 (≠ L133), P138 (= P135), G139 (≠ E136), L224 (≠ H220), F234 (≠ L230)
- binding acetoacetyl-coenzyme a: Q23 (≠ D21), A24 (≠ K22), L25 (≠ R23), A27 (= A25), A63 (≠ S61), G64 (= G62), A65 (≠ N63), D66 (= D64), I67 (≠ V65), K68 (≠ A66), M70 (≠ F68), F84 (= F85), G107 (= G104), G108 (≠ I105), E111 (≠ T108), P130 (= P127), E131 (≠ F128), P138 (= P135), G139 (≠ E136), M140 (≠ A137)
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
28% identity, 99% coverage: 4:245/245 of query aligns to 6:249/255 of 3q0gC
- active site: A65 (≠ N63), M70 (≠ F68), T80 (≠ V81), F84 (= F85), G108 (≠ I105), E111 (≠ T108), P130 (= P127), E131 (≠ F128), V136 (≠ L133), P138 (= P135), G139 (≠ E136), L224 (≠ H220), F234 (≠ L230)
- binding coenzyme a: L25 (≠ R23), A63 (≠ S61), I67 (≠ V65), K68 (≠ A66), Y104 (≠ A101), P130 (= P127), E131 (≠ F128), L134 (= L131)
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
28% identity, 99% coverage: 4:245/245 of query aligns to 5:248/256 of 3h81A
- active site: A64 (≠ N63), M69 (≠ F68), T79 (≠ V81), F83 (= F85), G107 (≠ I105), E110 (≠ T108), P129 (= P127), E130 (≠ F128), V135 (≠ L133), P137 (= P135), G138 (≠ E136), L223 (≠ H220), F233 (≠ L230)
- binding calcium ion: F233 (≠ L230), Q238 (≠ A235)
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
28% identity, 99% coverage: 4:245/245 of query aligns to 5:244/250 of 3q0gD
- active site: A64 (≠ N63), M69 (≠ F68), T75 (≠ P79), F79 (= F83), G103 (≠ I105), E106 (≠ T108), P125 (= P127), E126 (≠ F128), V131 (≠ L133), P133 (= P135), G134 (≠ E136), L219 (≠ H220), F229 (≠ L230)
- binding Butyryl Coenzyme A: F225 (= F226), F241 (= F242)
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
26% identity, 99% coverage: 4:245/245 of query aligns to 6:251/259 of 5zaiC
- active site: A65 (≠ N63), F70 (= F68), S82 (≠ H78), R86 (= R82), G110 (≠ I105), E113 (≠ T108), P132 (= P127), E133 (≠ F128), I138 (≠ L133), P140 (= P135), G141 (≠ E136), A226 (≠ H220), F236 (≠ L230)
- binding coenzyme a: K24 (= K22), L25 (≠ R23), A63 (≠ S61), G64 (= G62), A65 (≠ N63), D66 (= D64), I67 (≠ V65), P132 (= P127), R166 (≠ S161), F248 (= F242), K251 (= K245)
O53561 Enoyl-CoA hydratase EchA19; EC 4.2.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
29% identity, 95% coverage: 14:245/245 of query aligns to 20:258/266 of O53561
- K135 (= K123) modified: N6-succinyllysine; mutation to E: Nearly wild-type levels of succinylation in vitro, reduces specific activity 8-fold.
- 135:142 (vs. 123:130, 25% identical) mutation to EFGISEAE: Very low levels of succinylation in vitro, reduces specific activity 15-fold.
- K142 (≠ N130) modified: N6-succinyllysine; mutation to E: About 50% succinylation in vitro, reduces specific activity 7-fold.
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
26% identity, 97% coverage: 9:245/245 of query aligns to 14:250/258 of 1mj3A
- active site: A68 (≠ N63), M73 (≠ L69), S83 (≠ P79), L85 (≠ V81), G109 (≠ I105), E112 (≠ T108), P131 (= P127), E132 (≠ F128), T137 (≠ L133), P139 (= P135), G140 (≠ E136), K225 (≠ Q221), F235 (≠ L230)
- binding hexanoyl-coenzyme a: K26 (≠ D21), A27 (≠ K22), L28 (≠ R23), A30 (= A25), A66 (≠ S61), G67 (= G62), A68 (≠ N63), D69 (= D64), I70 (≠ V65), G109 (≠ I105), P131 (= P127), E132 (≠ F128), L135 (= L131), G140 (≠ E136)
6p5uE Structure of an enoyl-coa hydratase/aldolase isolated from a lignin- degrading consortium (see paper)
26% identity, 85% coverage: 1:209/245 of query aligns to 5:221/246 of 6p5uE
- active site: M67 (≠ N63), Y72 (≠ F68), D77 (= D73), R89 (≠ F83), A93 (≠ L87), G117 (≠ I105), T120 (= T108), E140 (≠ F128), I145 (≠ L133), P147 (= P135), A148 (≠ E136)
- binding coenzyme a: D25 (= D21), K26 (= K22), R27 (= R23), A29 (= A25), A65 (≠ S61), M67 (≠ N63), D68 (= D64), L69 (≠ V65), W113 (≠ A101), F115 (≠ V103), S139 (≠ P127), W143 (≠ L131)
Sites not aligning to the query:
3p85A Crystal structure enoyl-coa hydratase from mycobacterium avium (see paper)
31% identity, 71% coverage: 12:186/245 of query aligns to 11:173/224 of 3p85A
- active site: L62 (≠ N63), L67 (≠ F68), P68 (≠ S72), G92 (≠ I105), E95 (≠ T108), T114 (≠ P127), H115 (≠ F128), L120 (= L133), P122 (= P135), T123 (≠ E136)
- binding calcium ion: D43 (= D44), D45 (= D46)
Sites not aligning to the query:
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
26% identity, 97% coverage: 9:245/245 of query aligns to 12:250/258 of 1ey3A
- active site: A66 (≠ N63), M71 (≠ L69), S81 (≠ P79), L85 (= L84), G109 (≠ I105), E112 (≠ T108), P131 (= P127), E132 (≠ F128), T137 (≠ L133), P139 (= P135), G140 (≠ E136), K225 (≠ R214), F235 (≠ L230)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: K24 (≠ D21), L26 (≠ R23), A28 (= A25), A64 (≠ S61), G65 (= G62), A66 (≠ N63), D67 (= D64), I68 (≠ V65), L85 (= L84), W88 (vs. gap), G109 (≠ I105), P131 (= P127), L135 (= L131), G140 (≠ E136)
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
26% identity, 97% coverage: 9:245/245 of query aligns to 14:252/260 of 1dubA
- active site: A68 (≠ N63), M73 (≠ L69), S83 (≠ P79), L87 (= L84), G111 (≠ I105), E114 (≠ T108), P133 (= P127), E134 (≠ F128), T139 (≠ L133), P141 (= P135), G142 (≠ E136), K227 (≠ R214), F237 (≠ L230)
- binding acetoacetyl-coenzyme a: K26 (≠ D21), A27 (≠ K22), L28 (≠ R23), A30 (= A25), A66 (≠ S61), A68 (≠ N63), D69 (= D64), I70 (≠ V65), Y107 (≠ A101), G110 (= G104), G111 (≠ I105), E114 (≠ T108), P133 (= P127), E134 (≠ F128), L137 (= L131), G142 (≠ E136), F233 (= F226), F249 (= F242)
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
27% identity, 97% coverage: 9:245/245 of query aligns to 44:282/290 of P14604
- E144 (≠ T108) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (≠ F128) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
Q9P4U9 Enoyl-CoA hydratase AKT3-1; AF-toxin biosynthesis protein 3-1; EC 4.2.1.17 from Alternaria alternata (Alternaria rot fungus) (Torula alternata) (see paper)
28% identity, 97% coverage: 8:245/245 of query aligns to 21:263/296 of Q9P4U9
Sites not aligning to the query:
- 294:296 Peroxisomal targeting signal type 1
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
25% identity, 97% coverage: 9:245/245 of query aligns to 13:246/254 of 2dubA
- active site: A67 (≠ N63), M72 (≠ F68), S82 (vs. gap), G105 (≠ I105), E108 (≠ T108), P127 (= P127), E128 (≠ F128), T133 (≠ L133), P135 (= P135), G136 (≠ E136), K221 (≠ R214), F231 (≠ L230)
- binding octanoyl-coenzyme a: K25 (≠ D21), A26 (≠ K22), L27 (≠ R23), A29 (= A25), A65 (≠ S61), A67 (≠ N63), D68 (= D64), I69 (≠ V65), K70 (≠ A66), G105 (≠ I105), E108 (≠ T108), P127 (= P127), E128 (≠ F128), G136 (≠ E136), A137 (= A137)
6l3pA Crystal strcuture of feruloyl-coa hydratase lyase(fchl) complexed with coa
26% identity, 84% coverage: 1:205/245 of query aligns to 7:214/244 of 6l3pA
- active site: M69 (≠ N63), Y74 (≠ F68), R86 (≠ H78), Q90 (≠ R82), G114 (≠ I105), S117 (≠ T108), S136 (≠ P127), E137 (≠ F128), I142 (≠ L133), P144 (= P135), G145 (≠ E136)
- binding coenzyme a: K28 (= K22), R29 (= R23), A31 (= A25), A67 (≠ S61), M69 (≠ N63), D70 (= D64), L71 (≠ V65), G113 (= G104)
Sites not aligning to the query:
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
27% identity, 96% coverage: 12:245/245 of query aligns to 17:252/260 of 2hw5C
- active site: A68 (≠ N63), M73 (≠ L69), S83 (≠ P79), L87 (≠ V81), G111 (≠ I105), E114 (≠ T108), P133 (= P127), E134 (≠ F128), T139 (≠ L133), P141 (= P135), G142 (≠ E136), K227 (≠ H220), F237 (≠ L230)
- binding crotonyl coenzyme a: K26 (≠ D21), A27 (≠ K22), L28 (≠ R23), A30 (= A25), K62 (≠ N57), I70 (≠ V65), F109 (≠ V103)
7xwtB Crystal structure of feruoyl-coa hydratase/lyase complexed with coa from sphingomonas paucimobilis (see paper)
26% identity, 90% coverage: 12:231/245 of query aligns to 16:238/277 of 7xwtB
- binding acetyl coenzyme *a: T25 (≠ D21), K26 (= K22), R27 (= R23), A29 (= A25), A65 (≠ S61), G66 (= G62), M67 (≠ N63), D68 (= D64), L69 (≠ V65), F73 (≠ L69), F114 (≠ V103), G116 (≠ I105), S138 (≠ P127), W142 (≠ L131)
Query Sequence
>202993 FitnessBrowser__MR1:202993
MSHIQVRDDQGVRIISFNRPDKRNALDLNMYKQLTEYLIEGEADNDIRAFMLHGEDNCFT
SGNDVADFLKNSDLGPNHPAVRFLFCLLELKKPLVAAVSGAAVGIGTTVLLHCDLVYADN
SAKFQLPFVNLALVPEAGASLLLPELVGYQKAAELLLLGESFDANTAHRLNIINDVIAQE
ELLAYAFNQAKKLANQPPQALQITRQLMRPHKNRVQHQMHQELEQFGARLKSDEAKARFQ
AFLKK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory