Comparing 203038 FitnessBrowser__MR1:203038 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
64% identity, 95% coverage: 9:267/272 of query aligns to 4:262/262 of 7chaI
7ch6C Cryo-em structure of e.Coli mlafeb with amppnp (see paper)
66% identity, 95% coverage: 8:266/272 of query aligns to 4:262/265 of 7ch6C
6xgyA Crystal structure of e. Coli mlafb abc transport subunits in the dimeric state (see paper)
66% identity, 95% coverage: 8:266/272 of query aligns to 4:262/264 of 6xgyA
7cgnB The overall structure of the mlafedb complex in atp-bound eqtall conformation (mutation of e170q on mlaf) (see paper)
66% identity, 95% coverage: 8:266/272 of query aligns to 4:262/263 of 7cgnB
7ch8I Cryo-em structure of p.Aeruginosa mlafebd with adp-v (see paper)
63% identity, 95% coverage: 9:267/272 of query aligns to 4:259/259 of 7ch8I
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
62% identity, 93% coverage: 8:261/272 of query aligns to 4:257/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
62% identity, 93% coverage: 8:261/272 of query aligns to 4:257/263 of 7d08B
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
63% identity, 92% coverage: 8:256/272 of query aligns to 2:250/253 of 6z5uK
Q9AT00 Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic; ABC transporter I family member 13; ABC transporter ABCI.13; AtABCI13; Non-intrinsic ABC protein 11; AtNAP11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 91% coverage: 8:254/272 of query aligns to 84:345/345 of Q9AT00
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 93% coverage: 16:268/272 of query aligns to 11:260/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
32% identity, 93% coverage: 16:268/272 of query aligns to 12:261/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
32% identity, 93% coverage: 16:268/272 of query aligns to 12:261/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
32% identity, 93% coverage: 16:268/272 of query aligns to 12:261/344 of 3tuiC
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
35% identity, 86% coverage: 17:250/272 of query aligns to 35:269/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
35% identity, 86% coverage: 17:250/272 of query aligns to 35:269/382 of 7aheC
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
35% identity, 82% coverage: 16:238/272 of query aligns to 13:232/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
35% identity, 82% coverage: 16:238/272 of query aligns to 13:232/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
35% identity, 82% coverage: 16:238/272 of query aligns to 13:232/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
35% identity, 82% coverage: 16:238/272 of query aligns to 13:232/353 of Q97UY8
7ahdC Opua (e190q) occluded (see paper)
36% identity, 76% coverage: 26:232/272 of query aligns to 44:250/260 of 7ahdC
Sites not aligning to the query:
>203038 FitnessBrowser__MR1:203038
MTQEQTPLVEIRHLGFRRGQRVIYEDISLSIPRGKVTAIMGPSGIGKTTLLKLIGGQLTP
DSGQVLFDGQDVHAASRNELFELRKRMSMLFQSGALFTDINVFDNVAFALREHSGLPEEI
IRTIVLMKLEAVGLRGAAQLMPSELSGGMQRRAALARAIALEPEMVMYDEPFAGQDPISM
GVLVKLIRELSDALNLTSVVVSHDVDEVLGIADYVYVVADKKVIAHGTPEELKHADNPQL
KQFIEGAPDGPVPFHYPAKDYQQELLAKGVGK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory