Comparing 203176 FitnessBrowser__MR1:203176 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q94JV5 Deaminated glutathione amidase, chloroplastic/cytosolic; dGSH amidase; Nitrilase-like protein 2; Protein nitrilase 1 homolog; AtNit1; Protein Nit1 homolog; EC 3.5.1.128 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 95% coverage: 1:269/282 of query aligns to 37:298/307 of Q94JV5
Sites not aligning to the query:
Q9NQR4 Omega-amidase NIT2; Nitrilase homolog 2; EC 3.5.1.3 from Homo sapiens (Human) (see 2 papers)
33% identity, 98% coverage: 1:277/282 of query aligns to 4:268/276 of Q9NQR4
4hg5A Structural insights into yeast nit2: wild-type yeast nit2 in complex with oxaloacetate (see paper)
36% identity, 97% coverage: 2:274/282 of query aligns to 4:299/304 of 4hg5A
4hg3A Structural insights into yeast nit2: wild-type yeast nit2 in complex with alpha-ketoglutarate (see paper)
36% identity, 97% coverage: 2:274/282 of query aligns to 4:299/304 of 4hg3A
P47016 Deaminated glutathione amidase; dGSH amidase; Nitrilase homolog 1; EC 3.5.1.128 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
36% identity, 97% coverage: 2:274/282 of query aligns to 7:302/307 of P47016
4hgdA Structural insights into yeast nit2: c169s mutant of yeast nit2 in complex with an endogenous peptide-like ligand (see paper)
35% identity, 97% coverage: 2:274/282 of query aligns to 3:295/299 of 4hgdA
P46011 Bifunctional nitrilase/nitrile hydratase NIT4; Cyanoalanine nitrilase; Nitrilase 4; EC 3.5.5.1; EC 3.5.5.4; EC 4.2.1.65 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 92% coverage: 14:272/282 of query aligns to 41:323/355 of P46011
5h8jB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine (see paper)
27% identity, 96% coverage: 3:274/282 of query aligns to 7:280/297 of 5h8jB
5h8iC Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine (see paper)
27% identity, 96% coverage: 3:274/282 of query aligns to 11:284/301 of 5h8iC
6ypaB The c146a variant of an amidase from pyrococcus horikoshii with bound glutaramide
28% identity, 84% coverage: 23:258/282 of query aligns to 28:247/269 of 6ypaB
7ovgA The c146a variant of an amidase from pyrococcus horikoshii with bound acetamide (see paper)
27% identity, 89% coverage: 23:274/282 of query aligns to 22:257/263 of 7ovgA
3klcB Crystal structure of hyperthermophilic nitrilase (see paper)
28% identity, 86% coverage: 23:264/282 of query aligns to 20:243/261 of 3klcB
Sites not aligning to the query:
3klcA Crystal structure of hyperthermophilic nitrilase (see paper)
28% identity, 86% coverage: 23:264/282 of query aligns to 20:243/261 of 3klcA
Sites not aligning to the query:
5h8lB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine (see paper)
27% identity, 96% coverage: 3:274/282 of query aligns to 8:281/298 of 5h8lB
Q9UYV8 Nitrilase; PaNit; EC 3.5.5.1 from Pyrococcus abyssi (strain GE5 / Orsay) (see paper)
28% identity, 86% coverage: 23:264/282 of query aligns to 21:244/262 of Q9UYV8
4izuA The e41q mutant of the amidase from nesterenkonia sp. An1 showing the result of michael addition of acrylamide at the active site cysteine
26% identity, 95% coverage: 1:267/282 of query aligns to 2:249/254 of 4izuA
4iztA The e41q mutant of the amidase from nesterenkonia sp. An1 showing covalent addition of the acetamide moiety of fluoroacetamide at the active site cysteine
25% identity, 97% coverage: 1:273/282 of query aligns to 10:261/263 of 4iztA
5nycA A c145a mutant of nesterenkonia an1 amidase bound to propionitrile
26% identity, 95% coverage: 1:267/282 of query aligns to 9:256/261 of 5nycA
4izsA The c145a mutant of the amidase from nesterenkonia sp. An1 in complex with butyramide
26% identity, 95% coverage: 1:267/282 of query aligns to 9:256/261 of 4izsA
5nybA A c145a mutant of nesterenkonia an1 amidase bound to adipamide
25% identity, 97% coverage: 1:273/282 of query aligns to 9:260/262 of 5nybA
>203176 FitnessBrowser__MR1:203176
MRISLLQCQSSRDVSANLLFIESQLEELTQERQQWGDNSPHLVVLPECSLLFGGHESQQL
AYAGDSHHSQLKSALSALATRYRVFMVAGTIPALAEGGRVYSRCYLFDDKGDTLGHYDKL
HLFDVDVADGTKQYRESETFCPGDHISVIDTPFGKIGLSICYDLRFPDLFRAMRLAGAEI
ITVPSAFTKVTGEAHWQVLLQARAIETQCFIVAAAQWGAHNQGSRETWGQSMVIGPWGNI
IAERKTGTGWVHADIDLTEVNSIRSKMPVMQHNRFNVPMIKR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory