SitesBLAST
Comparing 203376 FitnessBrowser__MR1:203376 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4mchA Crystal structure of uridine phosphorylase from vibrio fischeri es114 complexed with 6-hydroxy-1-naphthoic acid, nysgrc target 029520.
55% identity, 100% coverage: 1:240/241 of query aligns to 6:241/243 of 4mchA
- active site: H11 (= H6), V23 (≠ A18), G27 (= G22), R31 (= R26), R49 (= R44), N55 (≠ R50), G56 (= G51), E81 (= E76), R92 (= R87), S95 (= S90), D169 (≠ Q164), V208 (= V203), V209 (= V204), Y211 (≠ F206), Y218 (= Y217)
- binding 6-hydroxynaphthalene-1-carboxylic acid: R34 (= R29), L38 (≠ H33), E229 (= E228), R230 (≠ Q229)
4yjkA Crystal structure of c212s mutant of shewanella oneidensis mr-1 uridine phosphorylase (see paper)
37% identity, 77% coverage: 18:202/241 of query aligns to 19:219/245 of 4yjkA
- active site: G23 (= G22), R27 (= R26), R45 (= R44), E77 (= E76), R88 (= R87), T91 (≠ S90), R165 (≠ Q164), I217 (≠ L200), V218 (≠ T201)
- binding uracil: T91 (≠ S90), T92 (≠ A91), G93 (= G92), F159 (= F158), Q163 (= Q162), R165 (≠ Q164), E193 (≠ D179)
Sites not aligning to the query:
4r2wD X-ray structure of uridine phosphorylase from shewanella oneidensis mr-1 in complex with uridine at 1.6 a resolution (see paper)
39% identity, 71% coverage: 18:188/241 of query aligns to 19:202/251 of 4r2wD
- active site: G23 (= G22), R27 (= R26), R45 (= R44), E77 (= E76), R88 (= R87), T91 (≠ S90), R165 (≠ Q164)
- binding glycerol: T91 (≠ S90), N130 (= N129), M194 (= M180), E195 (= E181)
- binding sulfate ion: G23 (= G22), R27 (= R26), R88 (= R87), G90 (= G89), T91 (≠ S90)
Sites not aligning to the query:
4r2wF X-ray structure of uridine phosphorylase from shewanella oneidensis mr-1 in complex with uridine at 1.6 a resolution (see paper)
39% identity, 71% coverage: 18:188/241 of query aligns to 19:202/242 of 4r2wF
- active site: G23 (= G22), R27 (= R26), R45 (= R44), E77 (= E76), R88 (= R87), T91 (≠ S90), R165 (≠ Q164)
- binding glycerol: N130 (= N129)
- binding sulfate ion: G23 (= G22), R27 (= R26), R88 (= R87), G90 (= G89), T91 (≠ S90)
- binding uridine: T91 (≠ S90), T92 (≠ A91), G93 (= G92), F159 (= F158), Q163 (= Q162), R165 (≠ Q164), Y192 (≠ A178), E193 (≠ D179), M194 (= M180), E195 (= E181)
Sites not aligning to the query:
1u1eA Structure of e. Coli uridine phosphorylase complexed to 5(phenylseleno)acyclouridine (psau) (see paper)
38% identity, 77% coverage: 18:202/241 of query aligns to 22:222/253 of 1u1eA
- active site: G26 (= G22), R30 (= R26), R48 (= R44), E80 (= E76), R91 (= R87), T94 (≠ S90), R168 (≠ Q164), I220 (≠ L200), V221 (≠ T201)
- binding 1-((2-hydroxyethoxy)methyl)-5-(phenylselanyl)pyrimidine-2,4(1h,3h)-dione: T94 (≠ S90), T95 (≠ A91), G96 (= G92), F162 (= F158), Q166 (= Q162), R168 (≠ Q164), E196 (≠ D179), M197 (= M180), I220 (≠ L200)
- binding phosphate ion: G26 (= G22), R30 (= R26), R91 (= R87), G93 (= G89), T94 (≠ S90)
Sites not aligning to the query:
1u1dA Structure of e. Coli uridine phosphorylase complexed to 5- (phenylthio)acyclouridine (ptau) (see paper)
38% identity, 77% coverage: 18:202/241 of query aligns to 22:222/253 of 1u1dA
- active site: G26 (= G22), R30 (= R26), R48 (= R44), E80 (= E76), R91 (= R87), T94 (≠ S90), R168 (≠ Q164), I220 (≠ L200), V221 (≠ T201)
- binding 1-((2-hydroxyethoxy)methyl)-5-(phenylthio)pyrimidine-2,4(1h,3h)-dione: T94 (≠ S90), T95 (≠ A91), G96 (= G92), F162 (= F158), Q166 (= Q162), R168 (≠ Q164), M197 (= M180), I220 (≠ L200)
- binding phosphate ion: G26 (= G22), R30 (= R26), R91 (= R87), G93 (= G89), T94 (≠ S90)
Sites not aligning to the query:
1u1cA Structure of e. Coli uridine phosphorylase complexed to 5- benzylacyclouridine (bau) (see paper)
38% identity, 77% coverage: 18:202/241 of query aligns to 22:222/253 of 1u1cA
- active site: G26 (= G22), R30 (= R26), R48 (= R44), E80 (= E76), R91 (= R87), T94 (≠ S90), R168 (≠ Q164), I220 (≠ L200), V221 (≠ T201)
- binding 1-((2-hydroxyethoxy)methyl)-5-benzylpyrimidine-2,4(1h,3h)-dione: T94 (≠ S90), T95 (≠ A91), G96 (= G92), F162 (= F158), Q166 (= Q162), R168 (≠ Q164), E196 (≠ D179), I220 (≠ L200)
- binding phosphate ion: G26 (= G22), R30 (= R26), R91 (= R87), G93 (= G89), T94 (≠ S90), E198 (= E181)
Sites not aligning to the query:
P12758 Uridine phosphorylase; UPase; UrdPase; EC 2.4.2.3 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 77% coverage: 18:202/241 of query aligns to 22:222/253 of P12758
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 5 mutation D->A,E,N: No change in activity.
1u1gA Structure of e. Coli uridine phosphorylase complexed to 5-(m- (benzyloxy)benzyl)barbituric acid (bbba) (see paper)
38% identity, 77% coverage: 18:202/241 of query aligns to 19:219/245 of 1u1gA
- active site: G23 (= G22), R27 (= R26), R45 (= R44), E77 (= E76), R88 (= R87), T91 (≠ S90), R165 (≠ Q164), I217 (≠ L200), V218 (≠ T201)
- binding 1-((2-hydroxyethoxy)methyl)-5-(3-(benzyloxy)benzyl)-6-hydroxypyrimidine-2,4(1h,3h)-dione: T91 (≠ S90), T92 (≠ A91), F159 (= F158), Q163 (= Q162), R165 (≠ Q164), M194 (= M180), I217 (≠ L200), V218 (≠ T201)
Sites not aligning to the query:
1rxsB E. Coli uridine phosphorylase: 2'-deoxyuridine phosphate complex (see paper)
38% identity, 77% coverage: 18:202/241 of query aligns to 19:219/246 of 1rxsB
- active site: R27 (= R26), R45 (= R44), E77 (= E76), R88 (= R87), R165 (≠ Q164), I217 (≠ L200), V218 (≠ T201)
- binding 2'-deoxyuridine: T91 (≠ S90), T92 (≠ A91), G93 (= G92), F159 (= F158), Q163 (= Q162), M194 (= M180), E195 (= E181)
- binding potassium ion: E46 (= E45), G65 (= G64), I66 (= I65), S70 (= S69)
- binding meta vanadate: R175 (≠ C167), H176 (= H168)
Sites not aligning to the query:
1rxsa E. Coli uridine phosphorylase: 2'-deoxyuridine phosphate complex (see paper)
38% identity, 77% coverage: 18:202/241 of query aligns to 19:219/242 of 1rxsa
- active site: R27 (= R26), R45 (= R44), E77 (= E76), R88 (= R87), R165 (≠ Q164), I217 (≠ L200), V218 (≠ T201)
- binding 2'-deoxyuridine: I66 (= I65), T91 (≠ S90), T92 (≠ A91), G93 (= G92), F159 (= F158), Q163 (= Q162), R165 (≠ Q164), M194 (= M180), E195 (= E181)
- binding potassium ion: E46 (= E45), G65 (= G64), I66 (= I65), S70 (= S69)
Sites not aligning to the query:
1tgyA Structure of e. Coli uridine phosphorylase complexed with uracil and ribose 1-phosphate
38% identity, 77% coverage: 18:202/241 of query aligns to 19:219/250 of 1tgyA
- active site: G23 (= G22), R27 (= R26), R45 (= R44), E77 (= E76), R88 (= R87), T91 (≠ S90), R165 (≠ Q164), I217 (≠ L200), V218 (≠ T201)
- binding 1-O-phosphono-alpha-D-ribofuranose: G23 (= G22), R27 (= R26), R45 (= R44), R88 (= R87), T91 (≠ S90), F159 (= F158), M194 (= M180), E195 (= E181)
- binding uracil: G93 (= G92), F159 (= F158), Q163 (= Q162), R165 (≠ Q164)
Sites not aligning to the query:
1rxcJ E. Coli uridine phosphorylase: 5-fluorouracil ribose-1-phosphate complex (see paper)
38% identity, 77% coverage: 18:202/241 of query aligns to 19:219/250 of 1rxcJ
- active site: G23 (= G22), R27 (= R26), R45 (= R44), E77 (= E76), R88 (= R87), T91 (≠ S90), R165 (≠ Q164), I217 (≠ L200), V218 (≠ T201)
- binding 5-fluorouridine: I66 (= I65), T91 (≠ S90), T92 (≠ A91), G93 (= G92), F159 (= F158), Q163 (= Q162), E193 (≠ D179), M194 (= M180), E195 (= E181), I217 (≠ L200)
- binding potassium ion: E46 (= E45), G65 (= G64), I66 (= I65), S70 (= S69)
- binding phosphate ion: G23 (= G22), R27 (= R26), R88 (= R87), G90 (= G89), T91 (≠ S90)
- binding 1-O-phosphono-alpha-D-ribofuranose: R45 (= R44)
Sites not aligning to the query:
1rxcB E. Coli uridine phosphorylase: 5-fluorouracil ribose-1-phosphate complex (see paper)
38% identity, 77% coverage: 18:202/241 of query aligns to 19:219/250 of 1rxcB
- active site: G23 (= G22), R27 (= R26), R45 (= R44), E77 (= E76), R88 (= R87), T91 (≠ S90), R165 (≠ Q164), I217 (≠ L200), V218 (≠ T201)
- binding potassium ion: E46 (= E45), G65 (= G64), I66 (= I65), S70 (= S69)
- binding 1-O-phosphono-alpha-D-ribofuranose: G23 (= G22), R27 (= R26), R88 (= R87), T91 (≠ S90), E193 (≠ D179), M194 (= M180), E195 (= E181)
- binding 5-fluorouracil: T91 (≠ S90), T92 (≠ A91), G93 (= G92), F159 (= F158), Q163 (= Q162), I217 (≠ L200), V218 (≠ T201)
Sites not aligning to the query:
3kvvA Trapping of an oxocarbenium ion intermediate in up crystals (see paper)
38% identity, 77% coverage: 18:202/241 of query aligns to 19:219/243 of 3kvvA
- active site: G23 (= G22), R27 (= R26), R45 (= R44), E77 (= E76), R88 (= R87), T91 (≠ S90), R165 (≠ Q164), I217 (≠ L200), V218 (≠ T201)
- binding 1,4-anhydro-D-erythro-pent-1-enitol: T91 (≠ S90), F159 (= F158), E193 (≠ D179), M194 (= M180), E195 (= E181)
- binding sulfate ion: G23 (= G22), R27 (= R26), R88 (= R87), G90 (= G89), T91 (≠ S90)
- binding 5-fluorouracil: T91 (≠ S90), T92 (≠ A91), G93 (= G92), F159 (= F158), Q163 (= Q162), R165 (≠ Q164), I217 (≠ L200), V218 (≠ T201)
Sites not aligning to the query:
1u1fA Structure of e. Coli uridine phosphorylase complexed to 5-(m- (benzyloxy)benzyl)acyclouridine (bbau) (see paper)
38% identity, 77% coverage: 18:202/241 of query aligns to 19:219/243 of 1u1fA
- active site: G23 (= G22), R27 (= R26), R45 (= R44), E77 (= E76), R88 (= R87), T91 (≠ S90), R165 (≠ Q164), I217 (≠ L200), V218 (≠ T201)
- binding 1-((2-hydroxyethoxy)methyl)-5-(3-(benzyloxy)benzyl)pyrimidine-2,4(1h,3h)-dione: R45 (= R44), T91 (≠ S90), T92 (≠ A91), G93 (= G92), F159 (= F158), Q163 (= Q162), R165 (≠ Q164), E193 (≠ D179), M194 (= M180), I217 (≠ L200), V218 (≠ T201)
- binding phosphate ion: G23 (= G22), R27 (= R26), R88 (= R87), G90 (= G89), T91 (≠ S90)
Sites not aligning to the query:
1rxcA E. Coli uridine phosphorylase: 5-fluorouracil ribose-1-phosphate complex (see paper)
38% identity, 77% coverage: 18:202/241 of query aligns to 19:219/246 of 1rxcA
- active site: G23 (= G22), R27 (= R26), R45 (= R44), E77 (= E76), R88 (= R87), T91 (≠ S90), R165 (≠ Q164), I217 (≠ L200), V218 (≠ T201)
- binding potassium ion: E46 (= E45), G65 (= G64), I66 (= I65), S70 (= S69)
- binding 1-O-phosphono-alpha-D-ribofuranose: R45 (= R44)
Sites not aligning to the query:
1zl2B Crystal structure of the uridine phosphorylase from salmonella typhimurium in complex with 2,2'-anhydrouridine and phosphate ion at 1.85a resolution
37% identity, 79% coverage: 13:202/241 of query aligns to 14:219/242 of 1zl2B
- active site: R27 (= R26), R45 (= R44), R88 (= R87), R165 (vs. gap), I217 (≠ L200), V218 (≠ T201)
- binding 2,2'-Anhydro-(1-beta-D-arabinofuranosyl)uracil: T91 (≠ S90), T92 (≠ A91), F159 (= F158), Q163 (= Q162), R165 (vs. gap), E193 (≠ D179), M194 (= M180), E195 (= E181), I217 (≠ L200)
1y1rB Crystal structure of the uridine phosphorylase from salmonella typhimurium in complex with inhibitor and phosphate ion at 2.11a resolution
37% identity, 79% coverage: 13:202/241 of query aligns to 14:219/242 of 1y1rB
- active site: G23 (= G22), R27 (= R26), R45 (= R44), E77 (= E76), R88 (= R87), T91 (≠ S90), R165 (vs. gap), I217 (≠ L200), V218 (≠ T201)
- binding 2,2'-Anhydro-(1-beta-D-ribofuranosyl)uracil: I66 (= I65), T91 (≠ S90), T92 (≠ A91), G93 (= G92), F159 (= F158), Q163 (= Q162), R165 (vs. gap), E193 (≠ D179), M194 (= M180), E195 (= E181), I217 (≠ L200)
Sites not aligning to the query:
2hwuA Crystal structure of the uridine phosphorylase from salmonella typhimurium in complex with uridine and phosphate ion at 2.91a resolution
37% identity, 79% coverage: 13:202/241 of query aligns to 17:222/253 of 2hwuA
- active site: R30 (= R26), R48 (= R44), R91 (= R87), R168 (vs. gap), I220 (≠ L200), V221 (≠ T201)
- binding uridine: T94 (≠ S90), T95 (≠ A91), G96 (= G92), F162 (= F158), Q166 (= Q162), E196 (≠ D179), M197 (= M180), E198 (= E181)
Query Sequence
>203376 FitnessBrowser__MR1:203376
MSIQPHILVAPHQVSEKAVVCGEPNRVNRIVAHLTDVESLADNREFRLMRGRYGDTIVTV
CSTGIGAPSAIIALEELYQCGVKQLIRIGSAGALQPQIAIGDVIIAEAAVRDDGGSASYV
KPGFPAYANHRLVGKLQAYCAQHHICAHSGVVRSHDSFYTDQEQDLCHYWHRQGVLGADM
ETAALFTVGRLRQLEVAAILTNVVLFDQDVKAGVNDYVASSKASAQGEQHAILAALNALC
D
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory