SitesBLAST
Comparing 203417 FitnessBrowser__MR1:203417 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6yu5A Crystal structure of mhst in complex with l-valine (see paper)
32% identity, 98% coverage: 10:453/454 of query aligns to 3:441/441 of 6yu5A
6yu3A Crystal structure of mhst in complex with l-phenylalanine (see paper)
32% identity, 98% coverage: 10:453/454 of query aligns to 3:441/441 of 6yu3A
6yu2A Crystal structure of mhst in complex with l-isoleucine (see paper)
32% identity, 98% coverage: 10:453/454 of query aligns to 3:441/441 of 6yu2A
4us3A Crystal structure of the bacterial nss member mhst in an occluded inward-facing state (see paper)
32% identity, 98% coverage: 10:453/454 of query aligns to 3:441/441 of 4us3A
- binding sodium ion: G17 (= G24), A19 (= A26), V20 (= V27), V20 (= V27), G21 (= G28), N24 (= N31), T224 (≠ S230), D256 (= D262), A313 (= A331), S316 (≠ T334), S317 (= S335)
- binding tryptophan: S18 (= S25), A19 (= A26), L22 (≠ V29), G23 (= G30), Y101 (= Y112), F223 (= F229), T224 (≠ S230), S226 (≠ T232), M229 (≠ T235), S320 (= S338), L321 (≠ I339)
6yu7A Crystal structure of mhst in complex with l-tyrosine (see paper)
32% identity, 98% coverage: 10:453/454 of query aligns to 3:441/442 of 6yu7A
6yu4A Crystal structure of mhst in complex with l-4f-phenylalanine (see paper)
32% identity, 98% coverage: 10:453/454 of query aligns to 3:441/442 of 6yu4A
- binding 4-fluoro-l-phenylalanine: S18 (= S25), A19 (= A26), G21 (= G28), L22 (≠ V29), G23 (= G30), Y101 (= Y112), F223 (= F229), T224 (≠ S230), S226 (≠ T232), M229 (≠ T235), L321 (≠ I339)
6yu6B Crystal structure of mhst in complex with l-leucine (see paper)
32% identity, 98% coverage: 10:453/454 of query aligns to 3:441/446 of 6yu6B
4us4A Crystal structure of the bacterial nss member mhst in an occluded inward-facing state (lipidic cubic phase form) (see paper)
32% identity, 96% coverage: 17:453/454 of query aligns to 1:432/433 of 4us4A
- binding (2s)-2,3-dihydroxypropyl(7z)-pentadec-7-enoate: A173 (= A188), T180 (≠ S195), I287 (≠ L312), R288 (≠ T315), L289 (≠ A316)
- binding sodium ion: G8 (= G24), S9 (= S25), A10 (= A26), V11 (= V27), V11 (= V27), N15 (= N31), T215 (≠ S230), D247 (= D262), A304 (= A331), S307 (≠ T334), S308 (= S335)
- binding tryptophan: S9 (= S25), A10 (= A26), G12 (= G28), G14 (= G30), Y92 (= Y112), F214 (= F229), T215 (≠ S230), S217 (≠ T232), M220 (≠ T235), L312 (≠ I339)
3gwwA Leucine transporter leut in complex with s-fluoxetine (see paper)
30% identity, 77% coverage: 10:360/454 of query aligns to 2:371/501 of 3gwwA
- binding leucine: A18 (= A26), G20 (= G28), G22 (= G30), Y104 (= Y112), F244 (= F229), T245 (≠ S230), S247 (≠ T232), F250 (≠ T235), I350 (= I339)
- binding (3S)-N-methyl-3-phenyl-3-[4-(trifluoromethyl)phenoxy]propan-1-amine: L21 (≠ V29), G22 (= G30), R26 (≠ G34), Y104 (= Y112), A310 (≠ K293), F311 (≠ L294)
Sites not aligning to the query:
3gwvA Leucine transporter leut in complex with r-fluoxetine (see paper)
30% identity, 77% coverage: 10:360/454 of query aligns to 2:374/498 of 3gwvA
- binding leucine: A18 (= A26), G20 (= G28), G22 (= G30), Y104 (= Y112), F247 (= F229), T248 (≠ S230), S250 (≠ T232), F253 (≠ T235)
- binding (3R)-N-methyl-3-phenyl-3-[4-(trifluoromethyl)phenoxy]propan-1-amine: L21 (≠ V29), R26 (≠ G34), A313 (≠ K293), F314 (≠ L294)
Sites not aligning to the query:
2q6hA Crystal structure analysis of leut complexed with l-leucine, sodium, and clomipramine (see paper)
30% identity, 78% coverage: 8:360/454 of query aligns to 2:376/512 of 2q6hA
- binding 3-(3-chloro-5h-dibenzo[b,f]azepin-5-yl)-n,n-dimethylpropan-1-amine: R28 (≠ G34), Q32 (= Q38), R189 (≠ K173), F190 (≠ W174), I193 (≠ R177), F316 (≠ L294), F346 (≠ I330)
- binding leucine: A20 (= A26), G22 (= G28), G24 (= G30), Y106 (= Y112), F249 (= F229), T250 (≠ S230), S252 (≠ T232), F255 (≠ T235)
- binding sodium ion: G18 (= G24), A20 (= A26), V21 (= V27), V21 (= V27), G22 (= G28), N25 (= N31), T250 (≠ S230), N282 (≠ T261), A347 (= A331), T350 (= T334), S351 (= S335)
Sites not aligning to the query:
3uspA Crystal structure of leut in heptyl-beta-d-selenoglucoside (see paper)
30% identity, 77% coverage: 10:360/454 of query aligns to 2:374/503 of 3uspA
- binding heptyl 1-seleno-beta-D-glucopyranoside: K117 (≠ A125), L122 (vs. gap), E153 (≠ R147), I155 (≠ L149), K157 (≠ F151), P158 (≠ T152), F161 (= F155), Y163 (≠ T157)
- binding leucine: A18 (= A26), G20 (= G28), G22 (= G30), F247 (= F229), T248 (≠ S230), S250 (≠ T232), F253 (≠ T235)
- binding sodium ion: G16 (= G24), A18 (= A26), V19 (= V27), V19 (= V27), G20 (= G28), N23 (= N31), T248 (≠ S230), N280 (≠ T261), A345 (= A331), T348 (= T334), S349 (= S335)
Sites not aligning to the query:
3gwuA Leucine transporter leut in complex with sertraline (see paper)
30% identity, 77% coverage: 10:360/454 of query aligns to 2:374/509 of 3gwuA
- binding leucine: A18 (= A26), G20 (= G28), G22 (= G30), Y104 (= Y112), F247 (= F229), T248 (≠ S230), S250 (≠ T232), F253 (≠ T235)
- binding (1S,4S)-4-(3,4-dichlorophenyl)-N-methyl-1,2,3,4-tetrahydronaphthalen-1-amine: L25 (≠ W33), R26 (≠ G34), Y104 (= Y112), F247 (= F229), A313 (≠ K293)
Sites not aligning to the query:
3f4jA Crystal structure of leut bound to glycine and sodium (see paper)
30% identity, 77% coverage: 10:360/454 of query aligns to 2:374/509 of 3f4jA
- binding glycine: A18 (= A26), G20 (= G28), G22 (= G30), Y104 (= Y112), F247 (= F229), T248 (≠ S230), S250 (≠ T232)
- binding sodium ion: G16 (= G24), A18 (= A26), V19 (= V27), V19 (= V27), G20 (= G28), G22 (= G30), N23 (= N31), T248 (≠ S230), N280 (≠ T261), A345 (= A331), G346 (= G332), T348 (= T334), S349 (= S335)
3f3dA Crystal structure of leut bound to l-methionine and sodium (see paper)
30% identity, 77% coverage: 10:360/454 of query aligns to 2:374/509 of 3f3dA
- binding methionine: N17 (≠ S25), A18 (= A26), G20 (= G28), G22 (= G30), Y104 (= Y112), F247 (= F229), T248 (≠ S230), S250 (≠ T232), S349 (= S335), I353 (= I339)
- binding sodium ion: G16 (= G24), A18 (= A26), V19 (= V27), V19 (= V27), G20 (= G28), N23 (= N31), T248 (≠ S230), N280 (≠ T261), A345 (= A331), T348 (= T334), S349 (= S335)
3f3cA Crystal structure of leut bound to 4-fluoro-l-phenylalanine and sodium (see paper)
30% identity, 77% coverage: 10:360/454 of query aligns to 2:374/509 of 3f3cA
- binding sodium ion: G16 (= G24), A18 (= A26), V19 (= V27), V19 (= V27), G20 (= G28), N23 (= N31), T248 (≠ S230), N280 (≠ T261), A345 (= A331), T348 (= T334), S349 (= S335)
- binding 4-fluoro-l-phenylalanine: N17 (≠ S25), A18 (= A26), G20 (= G28), G22 (= G30), Y104 (= Y112), F247 (= F229), T248 (≠ S230), S250 (≠ T232), F253 (≠ T235), S349 (= S335), I353 (= I339)
2qeiA Crystal structure analysis of leut complexed with l-alanine, sodium, and clomipramine (see paper)
30% identity, 78% coverage: 8:360/454 of query aligns to 1:375/511 of 2qeiA
- binding alanine: A19 (= A26), G21 (= G28), G23 (= G30), Y105 (= Y112), F248 (= F229), T249 (≠ S230), S251 (≠ T232)
- binding 3-(3-chloro-5h-dibenzo[b,f]azepin-5-yl)-n,n-dimethylpropan-1-amine: R27 (≠ G34), V30 (≠ T37), Q31 (= Q38), Y104 (≠ F111), R180 (≠ Q165), R188 (≠ K173), F189 (≠ W174), F315 (≠ L294), F345 (≠ I330)
- binding sodium ion: G17 (= G24), A19 (= A26), V20 (= V27), V20 (= V27), G21 (= G28), N24 (= N31), T249 (≠ S230), N281 (≠ T261), A346 (= A331), T349 (= T334), S350 (= S335)
Sites not aligning to the query:
2q72A Crystal structure analysis of leut complexed with l-leucine, sodium, and imipramine (see paper)
30% identity, 78% coverage: 8:360/454 of query aligns to 1:375/511 of 2q72A
- binding 3-(5h-dibenzo[b,f]azepin-5-yl)-n,n-dimethylpropan-1-amine: R27 (≠ G34), V30 (≠ T37), Q31 (= Q38), R188 (≠ K173), F189 (≠ W174), I192 (≠ R177), A314 (≠ K293), F315 (≠ L294), F345 (≠ I330)
- binding leucine: A19 (= A26), G21 (= G28), L22 (≠ V29), G23 (= G30), Y105 (= Y112), F248 (= F229), T249 (≠ S230), S251 (≠ T232), F254 (≠ T235)
- binding sodium ion: G17 (= G24), A19 (= A26), V20 (= V27), V20 (= V27), G21 (= G28), N24 (= N31), T249 (≠ S230), N281 (≠ T261), A346 (= A331), T349 (= T334), S350 (= S335)
Sites not aligning to the query:
2qb4A Crystal structure analysis of leut complexed with l-leucine, sodium and desipramine (see paper)
30% identity, 77% coverage: 10:360/454 of query aligns to 2:374/510 of 2qb4A
- binding 3-(10,11-dihydro-5h-dibenzo[b,f]azepin-5-yl)-n-methylpropan-1-amine: R26 (≠ G34), V29 (≠ T37), Q30 (= Q38), I107 (≠ L115), R187 (≠ K173), F188 (≠ W174), I191 (≠ R177), A313 (≠ K293), F314 (≠ L294), F344 (≠ I330)
- binding leucine: A18 (= A26), G20 (= G28), L21 (≠ V29), G22 (= G30), Y104 (= Y112), F247 (= F229), T248 (≠ S230), S250 (≠ T232), F253 (≠ T235)
- binding sodium ion: G16 (= G24), A18 (= A26), V19 (= V27), V19 (= V27), G20 (= G28), N23 (= N31), T248 (≠ S230), N280 (≠ T261), A345 (= A331), T348 (= T334), S349 (= S335)
Sites not aligning to the query:
3uslA Crystal structure of leut bound to l-selenomethionine in space group c2 from lipid bicelles (see paper)
30% identity, 77% coverage: 10:360/454 of query aligns to 2:373/502 of 3uslA
- binding selenomethionine: A18 (= A26), G20 (= G28), G22 (= G30), Y104 (= Y112), F246 (= F229), T247 (≠ S230), S249 (≠ T232), S348 (= S335), I352 (= I339)
- binding sodium ion: G16 (= G24), N17 (≠ S25), A18 (= A26), V19 (= V27), V19 (= V27), G20 (= G28), N23 (= N31), T247 (≠ S230), N279 (≠ T261), A344 (= A331), T347 (= T334), S348 (= S335)
- binding phosphocholine: N83 (≠ R91), R84 (≠ S92), F85 (≠ L93)
Query Sequence
>203417 FitnessBrowser__MR1:203417
MQSANTNSTNHFSSRLGFIMAAAGSAVGVGNIWGFPTQAATHGGGAFLLVYLVLIFILGI
PMLMAELMIGRHGQTNPADAMGKLGCNSLTRSLGKTIGLISIVTAGLIYTFYSILSGWFV
SFAIAPIATAFGSNDTAAWLMDFSLSRNLVFTLIFSTLVFLVLLQGVQEGIEKWSKRLMP
LLLIMLIAGVAYIFSLNGASEGISALLTPNFAKAIAPDTLINALGQTFFSLTIGTGAMMV
YGSYLSQKENIAKLTVWVAFTDSGIAFLAAFLIIPAMYVAQHNGVQIFSPEGKLIDSDAL
VFTVLPALFSTLGDTANLIISVVFFMLLIIAGLTSAISIAEVPTSYVMQKCGFSRQRATL
IIGLLLTALSLLLAVFFETLFSFTIMLTTQMTQPLVALGIAIYLGWIWRQSQLLKAISKQ
EGVDATGLFWRIWPRYVKYVCPVLIIAIAIRQFV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory