SitesBLAST
Comparing 203425 FitnessBrowser__MR1:203425 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
45% identity, 99% coverage: 3:547/552 of query aligns to 95:660/667 of P09342
- C161 (= C68) modified: Disulfide link with 307
- P194 (≠ S101) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ V208) modified: Disulfide link with 161
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
45% identity, 99% coverage: 3:547/552 of query aligns to 92:657/664 of P09114
- P191 (≠ S101) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (= W465) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
45% identity, 99% coverage: 3:547/552 of query aligns to 13:578/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (= M251), R292 (= R277), W489 (= W465), S568 (≠ P537)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V376), G401 (= G377), Q402 (= Q378), H403 (= H379), G426 (= G402), M428 (= M404), G452 (= G428), D453 (= D429), G454 (= G430), S455 (= S431), L483 (= L459), G484 (= G460), M485 (= M461), V486 (= V462)
- binding flavin-adenine dinucleotide: R161 (= R150), G222 (= G205), G223 (= G206), G224 (= G207), T246 (= T231), L247 (= L232), M248 (≠ K233), M263 (= M248), L264 (= L249), M266 (= M251), H267 (= H252), G286 (= G271), R288 (= R273), V293 (= V278), D310 (= D295), I311 (= I296), D329 (= D314), V330 (≠ L315), M405 (= M381), G423 (≠ A399)
- binding magnesium ion: A37 (= A27), T82 (= T71), S83 (= S72), Q122 (= Q111), Y381 (≠ A357), D453 (= D429), M458 (= M434), Q461 (= Q437), N480 (= N456), H482 (≠ K458), K533 (≠ S502)
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
45% identity, 99% coverage: 3:547/552 of query aligns to 13:578/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V376), G401 (= G377), Q402 (= Q378), H403 (= H379), G426 (= G402), M428 (= M404), G452 (= G428), D453 (= D429), G454 (= G430), S455 (= S431), M458 (= M434), N480 (= N456), H482 (≠ K458), L483 (= L459), G484 (= G460), M485 (= M461), V486 (= V462)
- binding flavin-adenine dinucleotide: R161 (= R150), G222 (= G205), G223 (= G206), G224 (= G207), T246 (= T231), L247 (= L232), M248 (≠ K233), L264 (= L249), M266 (= M251), H267 (= H252), G286 (= G271), V287 (≠ A272), R288 (= R273), D290 (= D275), R292 (= R277), V293 (= V278), D310 (= D295), I311 (= I296), D329 (= D314), V330 (≠ L315), M405 (= M381), G423 (≠ A399)
- binding magnesium ion: F370 (≠ Y346), D453 (= D429), M458 (= M434), Q461 (= Q437), N480 (= N456), H482 (≠ K458), K533 (≠ S502)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (= M251), R292 (= R277), M485 (= M461), W489 (= W465), S568 (≠ P537)
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
45% identity, 99% coverage: 3:547/552 of query aligns to 13:578/582 of 5wj1A
- active site: Y33 (= Y23), G35 (= G25), G36 (= G26), A37 (= A27), S38 (≠ I28), E59 (= E48), T82 (= T71), F121 (= F110), Q122 (= Q111), E123 (= E112), K171 (= K160), M266 (= M251), V293 (= V278), V400 (= V376), G426 (= G402), M428 (= M404), D453 (= D429), N480 (= N456), H482 (≠ K458), L483 (= L459), M485 (= M461), V486 (= V462), W489 (= W465), H558 (≠ D527)
- binding flavin-adenine dinucleotide: R161 (= R150), G222 (= G205), G223 (= G206), G224 (= G207), T246 (= T231), L247 (= L232), M248 (≠ K233), M263 (= M248), L264 (= L249), G286 (= G271), R288 (= R273), V293 (= V278), D310 (= D295), I311 (= I296), D329 (= D314), V330 (≠ L315), M405 (= M381), G423 (≠ A399), G424 (= G400)
- binding magnesium ion: D453 (= D429), N480 (= N456), H482 (≠ K458)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (= M251), D291 (= D276), R292 (= R277), M485 (= M461), W489 (= W465), S568 (≠ P537)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V376), G401 (= G377), Q402 (= Q378), H403 (= H379), M428 (= M404), D453 (= D429), G454 (= G430), S455 (= S431), M458 (= M434), N480 (= N456), H482 (≠ K458), L483 (= L459), G484 (= G460), M485 (= M461), V486 (= V462)
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
45% identity, 99% coverage: 3:547/552 of query aligns to 13:578/582 of 5k6tA
- active site: Y33 (= Y23), G35 (= G25), G36 (= G26), A37 (= A27), S38 (≠ I28), E59 (= E48), T82 (= T71), F121 (= F110), Q122 (= Q111), E123 (= E112), K171 (= K160), M266 (= M251), V293 (= V278), V400 (= V376), G426 (= G402), M428 (= M404), D453 (= D429), N480 (= N456), H482 (≠ K458), L483 (= L459), M485 (= M461), V486 (= V462), W489 (= W465), H558 (≠ D527)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (= H252), R292 (= R277), M485 (= M461), W489 (= W465), S568 (≠ P537)
- binding flavin-adenine dinucleotide: R161 (= R150), G222 (= G205), G223 (= G206), G224 (= G207), T246 (= T231), L247 (= L232), M248 (≠ K233), L264 (= L249), G286 (= G271), R288 (= R273), D290 (= D275), R292 (= R277), V293 (= V278), D310 (= D295), I311 (= I296), D329 (= D314), V330 (≠ L315), Q404 (= Q380), M405 (= M381), G423 (≠ A399)
- binding magnesium ion: D453 (= D429), N480 (= N456), H482 (≠ K458)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V376), G401 (= G377), Q402 (= Q378), H403 (= H379), G426 (= G402), M428 (= M404), G452 (= G428), G454 (= G430), S455 (= S431), N480 (= N456), H482 (≠ K458), L483 (= L459), G484 (= G460)
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
45% identity, 99% coverage: 3:547/552 of query aligns to 13:578/582 of 5k6rA
- active site: Y33 (= Y23), G35 (= G25), G36 (= G26), A37 (= A27), S38 (≠ I28), E59 (= E48), T82 (= T71), F121 (= F110), Q122 (= Q111), E123 (= E112), K171 (= K160), M266 (= M251), V293 (= V278), V400 (= V376), G426 (= G402), M428 (= M404), D453 (= D429), N480 (= N456), H482 (≠ K458), L483 (= L459), M485 (= M461), V486 (= V462), W489 (= W465), H558 (≠ D527)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (= R277), W489 (= W465), S568 (≠ P537)
- binding flavin-adenine dinucleotide: R161 (= R150), G222 (= G205), G223 (= G206), G224 (= G207), T246 (= T231), L247 (= L232), M248 (≠ K233), L264 (= L249), M266 (= M251), G286 (= G271), R288 (= R273), R292 (= R277), V293 (= V278), D310 (= D295), I311 (= I296), G328 (= G313), D329 (= D314), V330 (≠ L315), M405 (= M381), G423 (≠ A399)
- binding magnesium ion: D453 (= D429), N480 (= N456), H482 (≠ K458)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V376), G401 (= G377), Q402 (= Q378), H403 (= H379), G426 (= G402), M428 (= M404), D453 (= D429), G454 (= G430), S455 (= S431), M458 (= M434), N480 (= N456), H482 (≠ K458), L483 (= L459), G484 (= G460), M485 (= M461), V486 (= V462)
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
45% identity, 99% coverage: 3:547/552 of query aligns to 13:578/582 of 1z8nA
- active site: Y33 (= Y23), G35 (= G25), G36 (= G26), A37 (= A27), S38 (≠ I28), E59 (= E48), T82 (= T71), F121 (= F110), Q122 (= Q111), E123 (= E112), K171 (= K160), M266 (= M251), V293 (= V278), V400 (= V376), G426 (= G402), M428 (= M404), D453 (= D429), N480 (= N456), H482 (≠ K458), L483 (= L459), M485 (= M461), V486 (= V462), W489 (= W465), H558 (≠ D527)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (= K124), R161 (= R150), Y191 (≠ L174), R194 (≠ T177), D291 (= D276), R292 (= R277), D312 (= D297), W489 (= W465), G569 (= G538)
- binding flavin-adenine dinucleotide: R161 (= R150), G222 (= G205), G224 (= G207), T246 (= T231), L247 (= L232), M248 (≠ K233), L264 (= L249), G265 (= G250), M266 (= M251), H267 (= H252), G286 (= G271), V287 (≠ A272), R288 (= R273), D290 (= D275), R292 (= R277), V293 (= V278), D310 (= D295), I311 (= I296), D329 (= D314), V330 (≠ L315), M405 (= M381), G423 (≠ A399), G424 (= G400)
- binding magnesium ion: D453 (= D429), N480 (= N456)
- binding thiamine diphosphate: V400 (= V376), G401 (= G377), Q402 (= Q378), H403 (= H379), G426 (= G402), M428 (= M404), G452 (= G428), G454 (= G430), S455 (= S431), N480 (= N456), H482 (≠ K458), L483 (= L459), G484 (= G460), M485 (= M461), V486 (= V462)
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
45% identity, 99% coverage: 3:547/552 of query aligns to 13:578/582 of 1yi1A
- active site: Y33 (= Y23), G35 (= G25), G36 (= G26), A37 (= A27), S38 (≠ I28), E59 (= E48), T82 (= T71), F121 (= F110), Q122 (= Q111), E123 (= E112), K171 (= K160), M266 (= M251), V293 (= V278), V400 (= V376), G426 (= G402), M428 (= M404), D453 (= D429), N480 (= N456), H482 (≠ K458), L483 (= L459), M485 (= M461), V486 (= V462), W489 (= W465), H558 (≠ D527)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (= D276), R292 (= R277), W489 (= W465), S568 (≠ P537)
- binding flavin-adenine dinucleotide: R161 (= R150), G223 (= G206), G224 (= G207), T246 (= T231), L247 (= L232), M248 (≠ K233), M263 (= M248), L264 (= L249), G265 (= G250), M266 (= M251), H267 (= H252), G286 (= G271), V287 (≠ A272), R288 (= R273), D290 (= D275), V293 (= V278), D310 (= D295), I311 (= I296), D329 (= D314), V330 (≠ L315), M405 (= M381), G423 (≠ A399), G424 (= G400)
- binding magnesium ion: D453 (= D429), N480 (= N456), H482 (≠ K458)
1yi0A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
45% identity, 99% coverage: 3:547/552 of query aligns to 13:578/582 of 1yi0A
- active site: Y33 (= Y23), G35 (= G25), G36 (= G26), A37 (= A27), S38 (≠ I28), E59 (= E48), T82 (= T71), F121 (= F110), Q122 (= Q111), E123 (= E112), K171 (= K160), M266 (= M251), V293 (= V278), V400 (= V376), G426 (= G402), M428 (= M404), D453 (= D429), N480 (= N456), H482 (≠ K458), L483 (= L459), M485 (= M461), V486 (= V462), W489 (= W465), H558 (≠ D527)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D276), R292 (= R277), W489 (= W465), S568 (≠ P537)
- binding flavin-adenine dinucleotide: R161 (= R150), G222 (= G205), G223 (= G206), G224 (= G207), T246 (= T231), L247 (= L232), M248 (≠ K233), L264 (= L249), G265 (= G250), M266 (= M251), H267 (= H252), G286 (= G271), V287 (≠ A272), R288 (= R273), D290 (= D275), R292 (= R277), V293 (= V278), D310 (= D295), I311 (= I296), G328 (= G313), D329 (= D314), V330 (≠ L315), M405 (= M381), G423 (≠ A399), G424 (= G400)
- binding magnesium ion: D453 (= D429), N480 (= N456), H482 (≠ K458)
1yhzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
45% identity, 99% coverage: 3:547/552 of query aligns to 13:578/582 of 1yhzA
- active site: Y33 (= Y23), G35 (= G25), G36 (= G26), A37 (= A27), S38 (≠ I28), E59 (= E48), T82 (= T71), F121 (= F110), Q122 (= Q111), E123 (= E112), K171 (= K160), M266 (= M251), V293 (= V278), V400 (= V376), G426 (= G402), M428 (= M404), D453 (= D429), N480 (= N456), H482 (≠ K458), L483 (= L459), M485 (= M461), V486 (= V462), W489 (= W465), H558 (≠ D527)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: D291 (= D276), R292 (= R277), M485 (= M461), W489 (= W465), S568 (≠ P537)
- binding flavin-adenine dinucleotide: R161 (= R150), G223 (= G206), G224 (= G207), T246 (= T231), L247 (= L232), M248 (≠ K233), L264 (= L249), M266 (= M251), H267 (= H252), G286 (= G271), V287 (≠ A272), R288 (= R273), D290 (= D275), V293 (= V278), D310 (= D295), I311 (= I296), D329 (= D314), V330 (≠ L315), Q404 (= Q380), M405 (= M381), G423 (≠ A399), G424 (= G400)
- binding magnesium ion: D453 (= D429), N480 (= N456), H482 (≠ K458)
1yhyA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
45% identity, 99% coverage: 3:547/552 of query aligns to 13:578/582 of 1yhyA
- active site: Y33 (= Y23), G35 (= G25), G36 (= G26), A37 (= A27), S38 (≠ I28), E59 (= E48), T82 (= T71), F121 (= F110), Q122 (= Q111), E123 (= E112), K171 (= K160), M266 (= M251), V293 (= V278), V400 (= V376), G426 (= G402), M428 (= M404), D453 (= D429), N480 (= N456), H482 (≠ K458), L483 (= L459), M485 (= M461), V486 (= V462), W489 (= W465), H558 (≠ D527)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D276), R292 (= R277), V486 (= V462), W489 (= W465), S568 (≠ P537)
- binding flavin-adenine dinucleotide: R161 (= R150), G222 (= G205), G223 (= G206), G224 (= G207), T246 (= T231), L247 (= L232), M248 (≠ K233), L264 (= L249), G265 (= G250), M266 (= M251), H267 (= H252), G286 (= G271), V287 (≠ A272), R288 (= R273), D290 (= D275), V293 (= V278), D310 (= D295), I311 (= I296), D329 (= D314), V330 (≠ L315), Q404 (= Q380), M405 (= M381), G423 (≠ A399), G424 (= G400)
- binding magnesium ion: D453 (= D429), N480 (= N456), H482 (≠ K458)
1ybhA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide chlorimuron ethyl (see paper)
45% identity, 99% coverage: 3:547/552 of query aligns to 13:578/582 of 1ybhA
- active site: Y33 (= Y23), G35 (= G25), G36 (= G26), A37 (= A27), S38 (≠ I28), E59 (= E48), T82 (= T71), F121 (= F110), Q122 (= Q111), E123 (= E112), K171 (= K160), M266 (= M251), V293 (= V278), V400 (= V376), G426 (= G402), M428 (= M404), D453 (= D429), N480 (= N456), H482 (≠ K458), L483 (= L459), M485 (= M461), V486 (= V462), W489 (= W465), H558 (≠ D527)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: M266 (= M251), D291 (= D276), R292 (= R277), M485 (= M461), W489 (= W465), S568 (≠ P537)
- binding flavin-adenine dinucleotide: R161 (= R150), G223 (= G206), G224 (= G207), T246 (= T231), L247 (= L232), M248 (≠ K233), L264 (= L249), M266 (= M251), H267 (= H252), G286 (= G271), V287 (≠ A272), R288 (= R273), D290 (= D275), V293 (= V278), D310 (= D295), I311 (= I296), D329 (= D314), V330 (≠ L315), Q404 (= Q380), M405 (= M381), G423 (≠ A399), G424 (= G400)
- binding magnesium ion: D453 (= D429), N480 (= N456), H482 (≠ K458)
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
45% identity, 99% coverage: 3:547/552 of query aligns to 98:663/670 of P17597
- A122 (= A27) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (= M29) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E48) binding
- S186 (= S90) binding
- P197 (≠ S101) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ A103) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q111) binding
- K220 (= K124) binding
- R246 (= R150) binding ; binding
- K256 (= K160) binding
- G308 (= G206) binding
- TL 331:332 (= TL 231:232) binding
- C340 (≠ H240) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (= LGMH 249:252) binding
- GVRFD 371:375 (≠ GARFD 271:275) binding
- DR 376:377 (= DR 276:277) binding
- DI 395:396 (= DI 295:296) binding
- DV 414:415 (≠ DL 314:315) binding
- QH 487:488 (= QH 378:379) binding
- GG 508:509 (≠ AG 399:400) binding
- GAM 511:513 (≠ GTM 402:404) binding
- D538 (= D429) binding
- DGS 538:540 (= DGS 429:431) binding
- N565 (= N456) binding
- NQHLGM 565:570 (≠ NQKLGM 456:461) binding
- H567 (≠ K458) binding
- W574 (= W465) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
- S653 (≠ P537) binding ; mutation to A: No effect on catalytic activity or sensitivity to herbicides.; mutation to F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; mutation to N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; mutation to T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
5k3sA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium (see paper)
45% identity, 99% coverage: 3:547/552 of query aligns to 13:578/583 of 5k3sA
- active site: Y33 (= Y23), G35 (= G25), G36 (= G26), A37 (= A27), S38 (≠ I28), E59 (= E48), T82 (= T71), F121 (= F110), Q122 (= Q111), E123 (= E112), K171 (= K160), M266 (= M251), V293 (= V278), V400 (= V376), G426 (= G402), M428 (= M404), D453 (= D429), N480 (= N456), H482 (≠ K458), L483 (= L459), M485 (= M461), V486 (= V462), W489 (= W465), H558 (≠ D527)
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: R292 (= R277), M485 (= M461), W489 (= W465), G569 (= G538)
- binding flavin-adenine dinucleotide: R161 (= R150), G222 (= G205), G223 (= G206), G224 (= G207), T246 (= T231), L247 (= L232), M248 (≠ K233), L264 (= L249), M266 (= M251), G286 (= G271), R288 (= R273), D290 (= D275), V293 (= V278), D310 (= D295), I311 (= I296), D329 (= D314), V330 (≠ L315), M405 (= M381), G423 (≠ A399)
- binding magnesium ion: D453 (= D429), N480 (= N456), H482 (≠ K458)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V376), G401 (= G377), Q402 (= Q378), H403 (= H379), G426 (= G402), M428 (= M404), D453 (= D429), G454 (= G430), S455 (= S431), N480 (= N456), H482 (≠ K458), L483 (= L459), G484 (= G460), M485 (= M461), V486 (= V462)
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
45% identity, 99% coverage: 3:547/552 of query aligns to 13:578/585 of 5k2oA
- active site: Y33 (= Y23), G35 (= G25), G36 (= G26), A37 (= A27), S38 (≠ I28), E59 (= E48), T82 (= T71), F121 (= F110), Q122 (= Q111), E123 (= E112), K171 (= K160), M266 (= M251), V293 (= V278), V400 (= V376), G426 (= G402), M428 (= M404), D453 (= D429), N480 (= N456), H482 (≠ K458), L483 (= L459), M485 (= M461), V486 (= V462), W489 (= W465), H558 (≠ D527)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (= M251), R292 (= R277), W489 (= W465), S568 (≠ P537)
- binding flavin-adenine dinucleotide: R161 (= R150), G222 (= G205), G223 (= G206), G224 (= G207), T246 (= T231), L247 (= L232), M248 (≠ K233), L264 (= L249), G286 (= G271), R288 (= R273), D290 (= D275), V293 (= V278), D310 (= D295), I311 (= I296), D329 (= D314), V330 (≠ L315), Q404 (= Q380), M405 (= M381), G423 (≠ A399)
- binding magnesium ion: D453 (= D429), N480 (= N456), H482 (≠ K458)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V376), G401 (= G377), Q402 (= Q378), H403 (= H379), M428 (= M404), D453 (= D429), G454 (= G430), S455 (= S431), N480 (= N456), H482 (≠ K458), L483 (= L459), G484 (= G460), M485 (= M461), V486 (= V462)
3ea4A Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester (see paper)
45% identity, 99% coverage: 3:547/552 of query aligns to 12:577/582 of 3ea4A
- active site: Y32 (= Y23), G34 (= G25), G35 (= G26), A36 (= A27), S37 (≠ I28), E58 (= E48), T81 (= T71), F120 (= F110), Q121 (= Q111), E122 (= E112), K170 (= K160), M265 (= M251), V292 (= V278), V399 (= V376), G425 (= G402), M427 (= M404), D452 (= D429), N479 (= N456), H481 (≠ K458), L482 (= L459), M484 (= M461), V485 (= V462), W488 (= W465), H557 (≠ D527)
- binding methyl 2-{[(4-methylpyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: D290 (= D276), R291 (= R277), W488 (= W465), S567 (≠ P537)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R150), G221 (= G205), G222 (= G206), G223 (= G207), T245 (= T231), L246 (= L232), M247 (≠ K233), L263 (= L249), G264 (= G250), M265 (= M251), H266 (= H252), G285 (= G271), R287 (= R273), D289 (= D275), R291 (= R277), D309 (= D295), I310 (= I296), G327 (= G313), D328 (= D314), V329 (≠ L315), M404 (= M381), G422 (≠ A399)
- binding magnesium ion: D452 (= D429), N479 (= N456), H481 (≠ K458)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V376), G400 (= G377), Q401 (= Q378), H402 (= H379), M427 (= M404), G451 (= G428), D452 (= D429), G453 (= G430), S454 (= S431), N479 (= N456), H481 (≠ K458), L482 (= L459), G483 (= G460), M484 (= M461), V485 (= V462)
3e9yA Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron (see paper)
45% identity, 99% coverage: 3:547/552 of query aligns to 12:577/582 of 3e9yA
- active site: Y32 (= Y23), G34 (= G25), G35 (= G26), A36 (= A27), S37 (≠ I28), E58 (= E48), T81 (= T71), F120 (= F110), Q121 (= Q111), E122 (= E112), K170 (= K160), M265 (= M251), V292 (= V278), V399 (= V376), G425 (= G402), M427 (= M404), D452 (= D429), N479 (= N456), H481 (≠ K458), L482 (= L459), M484 (= M461), V485 (= V462), W488 (= W465), H557 (≠ D527)
- binding N-[(4-methylpyrimidin-2-yl)carbamoyl]-2-nitrobenzenesulfonamide: D290 (= D276), R291 (= R277), W488 (= W465), S567 (≠ P537)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R150), G221 (= G205), G222 (= G206), G223 (= G207), T245 (= T231), L246 (= L232), M247 (≠ K233), L263 (= L249), G285 (= G271), R287 (= R273), D289 (= D275), R291 (= R277), D309 (= D295), I310 (= I296), G327 (= G313), D328 (= D314), V329 (≠ L315), M404 (= M381), G422 (≠ A399)
- binding magnesium ion: D452 (= D429), N479 (= N456), H481 (≠ K458)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V376), G400 (= G377), Q401 (= Q378), H402 (= H379), M427 (= M404), G451 (= G428), G453 (= G430), S454 (= S431), N479 (= N456), H481 (≠ K458), L482 (= L459), G483 (= G460), M484 (= M461), V485 (= V462)
1t9cA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
43% identity, 100% coverage: 2:551/552 of query aligns to 8:583/596 of 1t9cA
- active site: Y29 (= Y23), G31 (= G25), G32 (= G26), A33 (= A27), I34 (= I28), E55 (= E48), T78 (= T71), F117 (= F110), Q118 (= Q111), E119 (= E112), K167 (= K160), R227 (≠ D215), M263 (= M251), V290 (= V278), V406 (= V376), L431 (= L401), G432 (= G402), M434 (= M404), D459 (= D429), N486 (= N456), E488 (≠ K458), Q489 (≠ L459), M491 (= M461), V492 (= V462), W495 (= W465), L517 (= L488), G522 (≠ D493), L523 (≠ I494), K556 (≠ D527)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G26), V107 (= V100), P108 (≠ S101), F117 (= F110), K167 (= K160), D288 (= D276), R289 (= R277), W495 (= W465)
- binding flavin-adenine dinucleotide: R157 (= R150), G216 (= G205), A217 (≠ G206), G218 (= G207), N221 (≠ G209), T243 (= T231), L244 (= L232), Q245 (≠ K233), L261 (= L249), M263 (= M251), H264 (= H252), G283 (= G271), A284 (= A272), R285 (= R273), D287 (= D275), R289 (= R277), V290 (= V278), E316 (≠ D295), V317 (≠ I296), N321 (≠ E300), G334 (= G313), D335 (= D314), A336 (vs. gap), M411 (= M381), G429 (≠ A399), G430 (= G400)
- binding magnesium ion: D459 (= D429), N486 (= N456), E488 (≠ K458)
1t9dA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
43% identity, 100% coverage: 2:551/552 of query aligns to 8:583/596 of 1t9dA
- active site: Y29 (= Y23), G31 (= G25), G32 (= G26), A33 (= A27), I34 (= I28), E55 (= E48), T78 (= T71), F117 (= F110), Q118 (= Q111), E119 (= E112), K167 (= K160), R227 (≠ D215), M263 (= M251), V290 (= V278), V406 (= V376), L431 (= L401), G432 (= G402), M434 (= M404), D459 (= D429), N486 (= N456), E488 (≠ K458), Q489 (≠ L459), M491 (= M461), V492 (= V462), W495 (= W465), L517 (= L488), G522 (≠ D493), L523 (≠ I494), K556 (≠ D527)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G26), A33 (= A27), V107 (= V100), P108 (≠ S101), F117 (= F110), K167 (= K160), M263 (= M251), D288 (= D276), R289 (= R277), W495 (= W465)
- binding flavin-adenine dinucleotide: R157 (= R150), G216 (= G205), A217 (≠ G206), G218 (= G207), N221 (≠ G209), T243 (= T231), L244 (= L232), Q245 (≠ K233), M260 (= M248), L261 (= L249), H264 (= H252), G283 (= G271), A284 (= A272), R285 (= R273), D287 (= D275), R289 (= R277), V290 (= V278), E316 (≠ D295), V317 (≠ I296), N321 (≠ E300), G334 (= G313), D335 (= D314), A336 (vs. gap), Q410 (= Q380), M411 (= M381), G429 (≠ A399), G430 (= G400)
- binding magnesium ion: D459 (= D429), N486 (= N456), E488 (≠ K458)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E55 (= E48), P81 (= P74), Q118 (= Q111), G432 (= G402), M434 (= M404), M464 (= M434)
Query Sequence
>203425 FitnessBrowser__MR1:203425
MIRGADAVIKVLAAHGVTTVFGYPGGAIMPIYDALYGSPVEHLLSRHEQGAAFAAVGYAR
ASGKTGVCFATSGPGATNLITSLADALLDSVPVVAITGQVSTAVIGTDAFQEIDVLGMSL
SCTKHSFMVTDVNDLIPTLYQAFEIAASGRPGPVLVDIPKDIQIAHLEYRTPLLAVTNEP
QAEMSDINAARALLAQAKQPMLYVGGGVGMAGAVDQLRDFINTTGMPSVATLKGLGSIAH
GTPGYLGMLGMHGGKAANLAVQDCDLLVVAGARFDDRVTGRLATFANKAKVIHLDIDAAE
LGKLRQPDVAIAGDLRQIFPALAMSLNITPWQVEVEHLARKHQWDYQHPGSLIYAPAMLR
RLANKLPEDSVVCCDVGQHQMWVAQHMWFRRPEDHLSSAGLGTMGFGLPAAIGAQVARPD
ATVVTVSGDGSFMMNVQELTTIKRRKLPVKILLIDNQKLGMVKQWQQLFFEGRYSETDLS
DNPDFVQLASAFDIPGRTIFSSDEVEEALTEMLAAKGPYLLHVAIDDAFNVWPLVPPGAS
NSDMMDEMEKQT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory