SitesBLAST
Comparing 203487 FitnessBrowser__MR1:203487 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A9C5 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 from Escherichia coli (strain K12) (see 3 papers)
78% identity, 100% coverage: 1:469/469 of query aligns to 1:469/469 of P0A9C5
- M1 (= M1) modified: Initiator methionine, Removed
- Y398 (= Y398) modified: O-AMP-tyrosine
P0A1P6 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
77% identity, 100% coverage: 1:469/469 of query aligns to 1:469/469 of P0A1P6
1fpyA Crystal structure of glutamine synthetase from salmonella typhimurium with inhibitor phosphinothricin (see paper)
76% identity, 100% coverage: 2:469/469 of query aligns to 1:468/468 of 1fpyA
- binding adenosine-5'-diphosphate: G127 (= G128), E129 (= E130), E207 (= E208), T223 (= T224), F225 (= F226), H271 (= H272), S273 (= S274), R355 (= R356), E357 (= E358)
- binding manganese (ii) ion: E129 (= E130), E131 (= E132), E212 (= E213), E220 (= E221), H269 (= H270), E357 (= E358)
- binding phosphinothricin: E131 (= E132), E212 (= E213), G265 (= G266), H269 (= H270), R321 (= R322), E327 (= E328), R359 (= R360)
1f1hA Crystal structure of glutamine synthetase from salmonella typhimurium with thallium ions (see paper)
76% identity, 100% coverage: 2:469/469 of query aligns to 1:468/468 of 1f1hA
- binding adenosine-5'-diphosphate: E129 (= E130), E207 (= E208), H210 (= H211), E220 (= E221), T223 (= T224), F225 (= F226), H271 (= H272), S273 (= S274), R355 (= R356)
- binding manganese (ii) ion: E129 (= E130), E131 (= E132), E212 (= E213), E220 (= E221), H269 (= H270), E357 (= E358)
2lgsA Feedback inhibition of fully unadenylylated glutamine synthetase from salmonella typhimurium by glycine, alanine, and serine (see paper)
73% identity, 100% coverage: 2:469/469 of query aligns to 1:445/445 of 2lgsA
- binding glutamic acid: E125 (= E132), N258 (= N265), G259 (= G266), G261 (= G268), H263 (= H270), R315 (= R322), R349 (= R360)
- binding manganese (ii) ion: E123 (= E130), E125 (= E132), E206 (= E213), E214 (= E221), H263 (= H270), E347 (= E358)
1lgrA Interactions of nucleotides with fully unadenylylated glutamine synthetase from salmonella typhimurium (see paper)
73% identity, 100% coverage: 2:469/469 of query aligns to 1:445/445 of 1lgrA
- binding adenosine monophosphate: E201 (= E208), T217 (= T224), F219 (= F226), H265 (= H272), S267 (= S274), R345 (= R356)
- binding manganese (ii) ion: E123 (= E130), E125 (= E132), E206 (= E213), E214 (= E221), H263 (= H270), E347 (= E358)
P77961 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 from Synechocystis sp. (strain PCC 6803 / Kazusa)
57% identity, 99% coverage: 4:467/469 of query aligns to 6:471/473 of P77961
- E134 (= E132) binding
- E215 (= E213) binding
- E223 (= E221) binding
- E361 (= E358) binding
3ng0A Crystal structure of glutamine synthetase from synechocystis sp. Pcc 6803
57% identity, 99% coverage: 4:467/469 of query aligns to 4:463/465 of 3ng0A
- active site: D51 (= D51), E130 (= E130), E132 (= E132), E213 (= E213), E221 (= E221), H270 (= H270), R340 (= R340), E359 (= E358), R361 (= R360)
- binding phosphoaminophosphonic acid-adenylate ester: Y126 (≠ L126), E130 (= E130), K209 (≠ A209), I224 (≠ T224), F226 (= F226), H272 (= H272), S274 (= S274), R340 (= R340), R345 (= R345), R357 (= R356)
- binding manganese (ii) ion: E130 (= E130), E132 (= E132), E213 (= E213), E221 (= E221), H270 (= H270), E359 (= E358), R361 (= R360)
A0R079 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
51% identity, 99% coverage: 4:469/469 of query aligns to 7:478/478 of A0R079
- K14 (≠ E11) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P9WN39 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 5 papers)
52% identity, 99% coverage: 4:469/469 of query aligns to 7:478/478 of P9WN39
- E133 (= E130) binding
- E135 (= E132) binding
- E219 (= E213) binding
- E227 (= E221) binding
- H276 (= H270) binding
- E366 (= E358) binding
- Y406 (= Y398) modified: O-AMP-tyrosine; mutation to F: Unable to be adenylylated.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1htoA Crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis (see paper)
52% identity, 99% coverage: 4:469/469 of query aligns to 6:477/477 of 1htoA
- active site: D53 (= D51), E132 (= E130), E134 (= E132), E218 (= E213), E226 (= E221), H275 (= H270), R346 (= R340), E365 (= E358), R367 (= R360)
- binding adenosine monophosphate: Y128 (≠ L126), G130 (= G128), E132 (= E130), F231 (= F226), H277 (= H272), S279 (= S274), R363 (= R356)
- binding manganese (ii) ion: E132 (= E130), H275 (= H270), E365 (= E358)
4acfA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with imidazopyridine inhibitor ((4-(6-bromo-3- (butylamino)imidazo(1,2-a)pyridin-2-yl)phenoxy) acetic acid) and l- methionine-s-sulfoximine phosphate.
52% identity, 99% coverage: 4:469/469 of query aligns to 4:475/475 of 4acfA
- active site: D51 (= D51), E130 (= E130), E132 (= E132), E216 (= E213), E224 (= E221), H273 (= H270), R344 (= R340), E363 (= E358), R365 (= R360)
- binding {4-[6-bromo-3-(butylamino)imidazo[1,2-a]pyridin-2-yl]phenoxy}acetic acid: Y126 (≠ L126), F229 (= F226), H275 (= H272), Q276 (= Q273), W279 (≠ S276), N356 (vs. gap), K358 (= K353), R361 (= R356)
- binding magnesium ion: E130 (= E130), E130 (= E130), E132 (= E132), E216 (= E213), E224 (= E221), E224 (= E221), H273 (= H270), E363 (= E358)
- binding l-methionine-s-sulfoximine phosphate: E130 (= E130), E132 (= E132), E216 (= E213), E224 (= E221), G269 (= G266), H273 (= H270), R326 (= R322), E332 (= E328), R344 (= R340), R365 (= R360)
3zxvA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with tri-substituted imidazole inhibitor (4-(2-tert-butyl- 4-(6-methoxynaphthalen-2-yl)-1h-imidazol-5-yl)pyridin-2-amine) and l- methionine-s-sulfoximine phosphate (see paper)
52% identity, 99% coverage: 4:469/469 of query aligns to 4:475/475 of 3zxvA
- active site: D51 (= D51), E130 (= E130), E132 (= E132), E216 (= E213), E224 (= E221), H273 (= H270), R344 (= R340), E363 (= E358), R365 (= R360)
- binding magnesium ion: E130 (= E130), E130 (= E130), E132 (= E132), E216 (= E213), E224 (= E221), E224 (= E221), H273 (= H270), E363 (= E358)
- binding 4-(2-tert-butyl-4-(6-methoxynaphthalen-2-yl)-3h-imidazol-4-yl)pyridin-2-amine: Y126 (≠ L126), G128 (= G128), F229 (= F226), H275 (= H272), S277 (= S274), K358 (= K353), R361 (= R356)
- binding l-methionine-s-sulfoximine phosphate: E130 (= E130), E132 (= E132), E216 (= E213), E224 (= E221), G269 (= G266), H273 (= H270), R326 (= R322), E332 (= E328), R344 (= R340), R365 (= R360)
3zxrA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with tri-substituted imidazole inhibitor (3-(2-tert-butyl- 5-(pyridin-4-yl)-1h-imidazol-4-yl)quinoline) and l-methionine-s- sulfoximine phosphate. (see paper)
52% identity, 99% coverage: 4:469/469 of query aligns to 4:475/475 of 3zxrA
- active site: D51 (= D51), E130 (= E130), E132 (= E132), E216 (= E213), E224 (= E221), H273 (= H270), R344 (= R340), E363 (= E358), R365 (= R360)
- binding 3-(2-tert-butyl-5-(pyridin-4-yl)-1h-imidazol-4-yl)quinoline: G128 (= G128), F229 (= F226), H275 (= H272), S277 (= S274), R361 (= R356)
- binding magnesium ion: E130 (= E130), E130 (= E130), E132 (= E132), E216 (= E213), E224 (= E221), E224 (= E221), H273 (= H270), E363 (= E358)
- binding l-methionine-s-sulfoximine phosphate: E130 (= E130), E132 (= E132), E216 (= E213), E224 (= E221), H273 (= H270), R326 (= R322), E332 (= E328), R344 (= R340), R365 (= R360)
2bvcA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a transition state mimic (see paper)
52% identity, 99% coverage: 4:469/469 of query aligns to 4:475/475 of 2bvcA
- active site: D51 (= D51), E130 (= E130), E132 (= E132), E216 (= E213), E224 (= E221), H273 (= H270), R344 (= R340), E363 (= E358), R365 (= R360)
- binding adenosine-5'-diphosphate: E130 (= E130), E211 (= E208), K212 (≠ A209), N226 (≠ A223), F229 (= F226), H275 (= H272), S277 (= S274), R344 (= R340), R349 (= R345), R361 (= R356), E363 (= E358)
- binding magnesium ion: E130 (= E130), E130 (= E130), E132 (= E132), E216 (= E213), E224 (= E221), E224 (= E221), H273 (= H270), E363 (= E358)
- binding l-methionine-s-sulfoximine phosphate: E130 (= E130), E132 (= E132), E216 (= E213), E224 (= E221), G269 (= G266), H273 (= H270), R326 (= R322), E332 (= E328), R344 (= R340), R365 (= R360)
2whiA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a purine analogue inhibitor and l-methionine-s- sulfoximine phosphate. (see paper)
52% identity, 99% coverage: 4:469/469 of query aligns to 5:476/476 of 2whiA
- active site: D52 (= D51), E131 (= E130), E133 (= E132), E217 (= E213), E225 (= E221), H274 (= H270), R345 (= R340), E364 (= E358), R366 (= R360)
- binding 1-(3,4-dichlorobenzyl)-3,7-dimethyl-8-morpholin-4-yl-3,7-dihydro-1H-purine-2,6-dione: Y127 (≠ L126), G129 (= G128), F230 (= F226), H276 (= H272), S278 (= S274), W280 (≠ S276), K359 (= K353), R362 (= R356)
- binding magnesium ion: E131 (= E130), E131 (= E130), E133 (= E132), E217 (= E213), E225 (= E221), E225 (= E221), H274 (= H270), E364 (= E358)
- binding l-methionine-s-sulfoximine phosphate: E131 (= E130), E133 (= E132), E217 (= E213), E225 (= E221), G270 (= G266), H274 (= H270), R327 (= R322), E333 (= E328), R345 (= R340), R366 (= R360)
- binding phosphate ion: E131 (= E130), R350 (= R345), E364 (= E358)
4xycA Nanomolar inhibitors of mycobacterium tuberculosis glutamine synthetase 1: synthesis, biological evaluation and x-ray crystallographic studies (see paper)
51% identity, 99% coverage: 4:469/469 of query aligns to 4:466/466 of 4xycA
- active site: D51 (= D51), E121 (= E130), E123 (= E132), E207 (= E213), E215 (= E221), H264 (= H270), R335 (= R340), E354 (= E358), R356 (= R360)
- binding 9-phenyl-4H-imidazo[1,2-a]indeno[1,2-e]pyrazin-4-one: Y117 (≠ L126), F220 (= F226), H266 (= H272), S268 (= S274), W270 (≠ S276), K349 (= K353), A350 (≠ G354), R352 (= R356)
2wgsA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a purine analogue inhibitor. (see paper)
50% identity, 99% coverage: 4:469/469 of query aligns to 4:463/463 of 2wgsA
- active site: D51 (= D51), E126 (= E130), E128 (= E132), E212 (= E213), E220 (= E221), H269 (= H270), R340 (= R340), E359 (= E358), R361 (= R360)
- binding 1-(3,4-dichlorobenzyl)-3,7-dimethyl-8-morpholin-4-yl-3,7-dihydro-1H-purine-2,6-dione: Y122 (≠ L126), G124 (= G128), E126 (= E130), N222 (≠ A223), F225 (= F226), H271 (= H272), S273 (= S274), W275 (≠ S276), K354 (= K353), R357 (= R356)
5zlpJ Crystal structure of glutamine synthetase from helicobacter pylori (see paper)
47% identity, 100% coverage: 3:469/469 of query aligns to 9:478/478 of 5zlpJ
- binding adenosine-5'-diphosphate: Y132 (≠ L126), E136 (= E130), F215 (≠ E208), F232 (= F226), H278 (= H272), S280 (= S274), R351 (= R345), R362 (= R356)
- binding magnesium ion: E138 (= E132), E220 (= E213), E227 (= E221)
- binding phosphinothricin: E138 (= E132), E220 (= E213), G272 (= G266), H276 (= H270), E334 (= E328), R346 (= R340), R366 (= R360)
5zlpL Crystal structure of glutamine synthetase from helicobacter pylori (see paper)
47% identity, 99% coverage: 4:469/469 of query aligns to 4:476/476 of 5zlpL
- binding adenosine-5'-diphosphate: G132 (= G128), E134 (= E130), F213 (≠ E208), F230 (= F226), H276 (= H272), S278 (= S274), R349 (= R345), R360 (= R356)
- binding magnesium ion: E136 (= E132), E218 (= E213), E225 (= E221)
- binding (2s)-2-amino-4-[methyl(phosphonooxy)phosphoryl]butanoic acid: E136 (= E132), E218 (= E213), G270 (= G266), H274 (= H270), E332 (= E328), R344 (= R340), R364 (= R360)
Query Sequence
>203487 FitnessBrowser__MR1:203487
MSVESVLKQLEELEVKFVDLRFTDTKGKEQHVSIPSHQVDADFFEDGKMFDGSSIAGWKG
INESDMVLMPDPTTFVLDPFTEETTALIRCDVLEPGTMTGYDRDPRSIAKKAEEYLRSTG
IADTVLVGPEPEFFLFDDVRFGTDMSGCFVKIDAKEAAWNSGTSYEGGNTGHRPFVKGGY
FPVAPVDSSQDLRSAMCLVLEEMGQVVEAHHHEVATAGQNEIATRFNTLTKKADEIQILK
YVVHNMAHAYGKTATFMPKPIVGDNGSGMHVHQSLSKDGVNLFAGDKYAGLSETALYYIG
GIIKHARALNAFTNPSTNSYKRLVPHFEAPVMLAYSARNRSASIRIPVVPSPKGRRIETR
FPDPHANPYLGFAALLMAGIDGIQNKIHPGEAMDKDLYDLPAEEAAEIPQVATSLENALE
NLQADHEFLTRGGVFSEDFIQSYIALKSAEAERVARTTHPLEFEMYYSL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory