Comparing 203655 FitnessBrowser__MR1:203655 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8tzjA Cryo-em structure of vibrio cholerae ftse/ftsx complex (see paper)
64% identity, 91% coverage: 1:213/233 of query aligns to 2:215/220 of 8tzjA
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
65% identity, 93% coverage: 1:217/233 of query aligns to 1:217/219 of 8w6iD
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
65% identity, 93% coverage: 1:217/233 of query aligns to 1:217/222 of P0A9R7
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
64% identity, 93% coverage: 1:217/233 of query aligns to 1:217/218 of 8hd0A
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
56% identity, 94% coverage: 1:220/233 of query aligns to 1:220/222 of 8i6rB
8iddA Cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc (see paper)
45% identity, 94% coverage: 1:220/233 of query aligns to 2:222/225 of 8iddA
8igqA Cryo-em structure of mycobacterium tuberculosis adp bound ftsex/ripc complex in peptidisc (see paper)
45% identity, 94% coverage: 1:220/233 of query aligns to 2:222/227 of 8igqA
A5U7B7 Cell division ATP-binding protein FtsE from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) (see 2 papers)
45% identity, 94% coverage: 1:220/233 of query aligns to 1:221/229 of A5U7B7
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
42% identity, 93% coverage: 1:216/233 of query aligns to 3:218/229 of 6z67B
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
42% identity, 93% coverage: 1:216/233 of query aligns to 3:218/230 of 6z4wA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 93% coverage: 1:216/233 of query aligns to 1:220/343 of P30750
Sites not aligning to the query:
7mdyC Lolcde nucleotide-bound
43% identity, 92% coverage: 1:215/233 of query aligns to 2:220/226 of 7mdyC
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
43% identity, 92% coverage: 1:215/233 of query aligns to 5:223/233 of P75957
7arlD Lolcde in complex with lipoprotein and adp (see paper)
43% identity, 92% coverage: 1:215/233 of query aligns to 2:220/222 of 7arlD
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
37% identity, 93% coverage: 1:216/233 of query aligns to 2:221/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
37% identity, 93% coverage: 1:216/233 of query aligns to 2:221/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
37% identity, 93% coverage: 1:216/233 of query aligns to 2:221/344 of 3tuiC
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
42% identity, 92% coverage: 1:215/233 of query aligns to 4:222/229 of 7v8iD
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
38% identity, 95% coverage: 1:222/233 of query aligns to 1:230/232 of 1f3oA
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
37% identity, 91% coverage: 5:217/233 of query aligns to 7:218/223 of 2pclA
>203655 FitnessBrowser__MR1:203655
MIDFQQVSKIYPGGQMALEEVNFHLQKGEMAFLTGHSGAGKSTLLKLITVIERATTGRVA
INGHDIAKISSKHVPYLRRNIGMIFQNHHLLMDRSVFDNVALPLVIEGFSHGEIRKRVAG
ALDMVGLYGKERHNPIMLSGGEQQRVGIARAIVNKPPLLLADEPTGNLDPKLSMDILRLF
ETFNDAGTSVLIATHDLGLIARMKYRTFTLKQGRMLGAQELHHGHATARGNAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory