Comparing 203766 FitnessBrowser__MR1:203766 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4gltA Crystal structure of glutathione s-transferase mfla_2116 (target efi- 507160) from methylobacillus flagellatus kt with gsh bound
30% identity, 80% coverage: 1:173/215 of query aligns to 7:180/208 of 4gltA
3ublA Crystal structure of glutathione transferase (target efi-501770) from leptospira interrogans with gsh bound
28% identity, 79% coverage: 8:176/215 of query aligns to 10:163/212 of 3ublA
3touA Crystal structure of glutathione transferase (target efi-501058) from ralstonia solanacearum gmi1000 with gsh bound
28% identity, 78% coverage: 1:167/215 of query aligns to 2:167/212 of 3touA
Q12390 Glutathione S-transferase 2; GST-II; EC 2.5.1.18 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 86% coverage: 1:184/215 of query aligns to 19:212/233 of Q12390
3ibhA Crystal structure of saccharomyces cerevisiae gtt2 in complex with glutathione (see paper)
25% identity, 86% coverage: 1:184/215 of query aligns to 1:194/208 of 3ibhA
3ergA Crystal structure of gtt2 from saccharomyces cerevisiae in complex with glutathione sulfnate (see paper)
25% identity, 86% coverage: 1:184/215 of query aligns to 1:194/208 of 3ergA
5evoA Structure of dehydroascrobate reductase from pennisetum americanum in complex with two non-native ligands, acetate in the g-site and glycerol in the h-site (see paper)
24% identity, 72% coverage: 11:165/215 of query aligns to 23:159/213 of 5evoA
Sites not aligning to the query:
4mk3A Crystal structure of a glutathione transferase family member from cupriavidus metallidurans ch34, target efi-507362, with bound glutathione sulfinic acid (gso2h)
26% identity, 78% coverage: 1:167/215 of query aligns to 1:166/203 of 4mk3A
5a4wA Atgstf2 from arabidopsis thaliana in complex with quercetrin (see paper)
26% identity, 78% coverage: 1:167/215 of query aligns to 3:178/211 of 5a4wA
5a4vA Atgstf2 from arabidopsis thaliana in complex with quercetin (see paper)
26% identity, 78% coverage: 1:167/215 of query aligns to 3:178/211 of 5a4vA
5a4uA Atgstf2 from arabidopsis thaliana in complex with indole-3-aldehyde (see paper)
26% identity, 78% coverage: 1:167/215 of query aligns to 3:178/211 of 5a4uA
5a5kA Atgstf2 from arabidopsis thaliana in complex with camalexin (see paper)
26% identity, 78% coverage: 1:167/215 of query aligns to 2:177/210 of 5a5kA
1gnwA Structure of glutathione s-transferase (see paper)
26% identity, 78% coverage: 1:167/215 of query aligns to 2:177/210 of 1gnwA
1bx9A Glutathione s-transferase in complex with herbicide (see paper)
26% identity, 78% coverage: 1:167/215 of query aligns to 2:177/210 of 1bx9A
3pr8A Structure of glutathione s-transferase(pp0183) from pseudomonas putida in complex with gsh
29% identity, 88% coverage: 1:189/215 of query aligns to 2:187/218 of 3pr8A
1a0fA Crystal structure of glutathione s-transferase from escherichia coli complexed with glutathionesulfonic acid (see paper)
28% identity, 88% coverage: 1:190/215 of query aligns to 1:188/201 of 1a0fA
P0A9D2 Glutathione S-transferase GstA; GST B1-1; EC 2.5.1.18 from Escherichia coli (strain K12) (see 2 papers)
28% identity, 88% coverage: 1:190/215 of query aligns to 1:188/201 of P0A9D2
5j4uA Crystal structure of a glutathione s-transferase ptgstu30 from populus trichocarpa in complex with gsh
25% identity, 76% coverage: 9:171/215 of query aligns to 12:166/218 of 5j4uA
4chsA Crystal structure of a tau class glutathione transferase 10 from glycine max (see paper)
26% identity, 77% coverage: 9:174/215 of query aligns to 12:174/215 of 4chsA
1pmtA Glutathione transferase from proteus mirabilis (see paper)
28% identity, 89% coverage: 1:192/215 of query aligns to 1:194/201 of 1pmtA
>203766 FitnessBrowser__MR1:203766
MELFYHPLSRYSQKVLIALYEKQANFYPRITDLRDPLARKAFQQFYPSGKLPLLKTQEGQ
LLPESSIIIEYLDTHFQNGTELLPAEAERNLAVRLFDRLIDFDINNPLFQLEKLKYTPEG
HEFEIKQLEKQMFAQFQRLDSHLRQNHWVCGDSFTLADCALIPCLSYSFAHLNLLDLDEL
VRYWQQAQLRGAWMLVLEEVLLVEMEENTGIRSIP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory