SitesBLAST
Comparing 206111 MicrobesOnline__882:206111 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
1aorA Structure of a hyperthermophilic tungstopterin enzyme, aldehyde ferredoxin oxidoreductase (see paper)
27% identity, 93% coverage: 12:566/594 of query aligns to 3:564/605 of 1aorA
- binding fe (iii) ion: E332 (≠ A347), H383 (≠ V396)
- binding tungstopterin cofactor: R76 (≠ K82), A92 (≠ S98), N93 (≠ H99), G95 (= G101), R182 (= R190), A183 (≠ H191), G185 (= G193), R186 (= R194), E311 (≠ D326), E313 (= E328), D338 (≠ E353), D343 (= D358), T344 (≠ C359), R444 (≠ L452), H448 (= H456), I449 (vs. gap), K450 (vs. gap), D489 (≠ N493), C494 (= C498), L495 (= L499), F496 (= F500)
- binding iron/sulfur cluster: R76 (≠ K82), C288 (= C295), C291 (= C298), I293 (≠ V300), C295 (= C302), C494 (= C498), F496 (= F500)
1b4nA Formaldehyde ferredoxin oxidoreductase from pyrococcus furiosus, complexed with glutarate (see paper)
31% identity, 72% coverage: 12:440/594 of query aligns to 3:416/611 of 1b4nA
- binding calcium ion: G179 (≠ F189), E304 (≠ S324), D306 (= D326)
- binding glutaric acid: Y307 (= Y327), E308 (= E328), Y416 (= Y440)
- binding tungstopterin cofactor: K75 (= K82), G91 (≠ S98), N92 (≠ H99), L93 (≠ A100), G94 (= G101), R180 (= R190), A181 (≠ H191), A182 (≠ F192), G183 (= G193), R184 (= R194), D306 (= D326), E308 (= E328), N309 (≠ P329), D333 (≠ E353), M337 (≠ L357), D338 (= D358), T339 (≠ C359)
- binding iron/sulfur cluster: K75 (= K82), G283 (≠ A294), C284 (= C295), C287 (= C298), M289 (≠ V300), C291 (= C302)
Sites not aligning to the query:
- binding glutaric acid: 437, 473, 484
- binding tungstopterin cofactor: 436, 437, 438, 477, 478, 482, 483, 484, 485
- binding iron/sulfur cluster: 483, 485
1b25A Formaldehyde ferredoxin oxidoreductase from pyrococcus furiosus (see paper)
31% identity, 72% coverage: 12:440/594 of query aligns to 3:416/611 of 1b25A
- binding tungstopterin: K75 (= K82), G91 (≠ S98), N92 (≠ H99), L93 (≠ A100), G94 (= G101), G179 (≠ F189), R180 (= R190), A181 (≠ H191), G183 (= G193), R184 (= R194), T240 (= T250), E304 (≠ S324), D306 (= D326), Y307 (= Y327), E308 (= E328), N309 (≠ P329), D333 (≠ E353), D338 (= D358), T339 (≠ C359), I340 (≠ M360)
- binding iron/sulfur cluster: K75 (= K82), R180 (= R190), C284 (= C295), C287 (= C298), M289 (≠ V300), C291 (= C302)
Sites not aligning to the query:
8c0zB Cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum (see paper)
28% identity, 72% coverage: 16:440/594 of query aligns to 6:443/616 of 8c0zB
- binding magnesium ion: N92 (≠ H99), A182 (≠ H191)
- binding iron/sulfur cluster: R75 (≠ K82), C295 (= C295), C298 (= C298), C302 (= C302)
- binding tungsten cofactor: R75 (≠ K82), S91 (= S98), N92 (≠ H99), G94 (= G101), R181 (= R190), A182 (≠ H191), A183 (≠ F192), G184 (= G193), E329 (≠ D326), E331 (= E328), N356 (≠ E353), P362 (≠ C359)
Sites not aligning to the query:
8c0zA Cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum (see paper)
28% identity, 72% coverage: 16:440/594 of query aligns to 6:443/616 of 8c0zA
- binding iron/sulfur cluster: R181 (= R190), C295 (= C295), C298 (= C298), C302 (= C302)
- binding tungsten cofactor: R75 (≠ K82), N92 (≠ H99), G94 (= G101), R181 (= R190), A183 (≠ F192), G184 (= G193), R185 (= R194), E329 (≠ D326), E331 (= E328), N356 (≠ E353), P362 (≠ C359)
Sites not aligning to the query:
4z3zA Active site complex bambc of benzoyl coenzyme a reductase in complex with zinc (see paper)
28% identity, 67% coverage: 17:416/594 of query aligns to 9:419/652 of 4z3zA
Sites not aligning to the query:
6x1oC Wor5 from pyrococcus furiosus, as crystallized (see paper)
29% identity, 56% coverage: 66:400/594 of query aligns to 62:400/624 of 6x1oC
- binding magnesium ion: M194 (≠ F189), D323 (≠ V323), D326 (= D326)
- binding phosphate ion: R249 (≠ H246), Y296 (≠ T293)
- binding tungstopterin cofactor: K77 (≠ S81), S93 (= S98), V94 (≠ H99), L95 (≠ A100), S96 (≠ G101), H195 (≠ R190), A196 (≠ H191), A197 (≠ F192), G198 (= G193), Y199 (≠ R194), D326 (= D326), E328 (= E328), D353 (≠ E353), D358 (= D358), G359 (≠ C359), I360 (≠ M360)
- binding iron/sulfur cluster: S96 (≠ G101), D299 (≠ C295), C302 (= C298), C306 (= C302)
- binding (1R)-1-hydroxybutane-1-sulfonic acid: T253 (= T250), Y327 (= Y327), E328 (= E328)
Sites not aligning to the query:
- binding tungstopterin cofactor: 469, 470, 489, 490, 494, 495, 496, 497
- binding iron/sulfur cluster: 495, 497, 498
- binding (1R)-1-hydroxybutane-1-sulfonic acid: 446, 469
4z3yA Active site complex bambc of benzoyl coenzyme a reductase in complex with benzoyl-coa (see paper)
28% identity, 67% coverage: 17:416/594 of query aligns to 9:419/653 of 4z3yA
Sites not aligning to the query:
4z3wC Active site complex bambc of benzoyl coenzyme a reductase in complex with 1,5 dienoyl-coa (see paper)
28% identity, 67% coverage: 17:416/594 of query aligns to 9:419/653 of 4z3wC
- binding 1,5 Dienoyl-CoA: P249 (≠ A251), W259 (vs. gap), H260 (vs. gap), F323 (≠ Y320)
- binding magnesium ion: M94 (≠ H99), S183 (≠ F192)
- binding iron/sulfur cluster: R77 (≠ K82), R181 (= R190), C299 (= C295), C302 (= C298), M304 (≠ V300), C306 (= C302)
Sites not aligning to the query:
- binding 1,5 Dienoyl-CoA: 436, 438, 439, 440, 445, 458, 461, 466, 499, 500, 504
- binding iron/sulfur cluster: 534
Query Sequence
>206111 MicrobesOnline__882:206111
MTLRRWGMPIEGTASRVLHVDLESGASRVLLFEGRPHHLGGSGLAAALYDAYGLPESPAF
DPRQPLIFAIGPLSGFFPLMSKVVCGFRSPYTGEWAESHAGGRLALSLRFAGYDALMITG
RARTLSCLVVGSRRLEIHDVHYLRGQDVFTSGKYLRRYGKESSGHRSTVRIGPAGERGVT
FACANVDSFRHFGRLGAGAVMGGKNLKALVVTGDSGIELPEGRDYPKLYKEVYQSVTGTD
MMQKYHDLGTAENLLVLNELKALPWRNLQATTDPAIDGISGERFAEQLLLRQTACAGCPV
GCIHIGLLRQQFARDHEFLYKQVSYDYEPIFAQGSMLGLTNASDVLALLDETEKLGLDCM
SAGVALAWVAEAFEKGVVTEKETLGPVHFGNVATFVAALHHLANGTSEFWQALGKGVLYA
ADIYGGADFACVLGQEMAGYATGEVYFVSQALGFRHSHLDSGGYAYDQSAKDKDVDKAVR
HLLDDEYKRLTINCMVACLFARKAYPPERLQEALASLGMRAEADALPESGRAMQALRWSL
KFRTGFRPENVRIPKRFTEVVTWKGPMDVDYMDAVRQAYTSELYRMVVDAAREA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory