SitesBLAST
Comparing 206126 MicrobesOnline__882:206126 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5oasA Crystal structure of malate synthase g from pseudomonas aeruginosa in apo form. (see paper)
58% identity, 100% coverage: 1:726/729 of query aligns to 4:726/728 of 5oasA
5vfbA 1.36 angstrom resolution crystal structure of malate synthase g from pseudomonas aeruginosa in complex with glycolic acid.
58% identity, 99% coverage: 2:726/729 of query aligns to 1:722/724 of 5vfbA
P9WK16 Malate synthase G; EC 2.3.3.9 from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) (see paper)
59% identity, 100% coverage: 1:726/729 of query aligns to 1:725/741 of P9WK16
- R339 (= R343) active site, Proton acceptor
- D633 (= D634) active site, Proton donor
2gq3A Mycobacterium tuberculosis malate synthase in complex with magnesium, malate, and coenzyme a (see paper)
59% identity, 99% coverage: 2:726/729 of query aligns to 1:718/720 of 2gq3A
- active site: D267 (= D275), E269 (= E277), R335 (= R343), E430 (= E435), D458 (= D463), D626 (= D634)
- binding coenzyme a: V114 (= V118), V115 (= V119), R121 (= R125), F122 (≠ Y126), N125 (= N129), A126 (= A130), K301 (= K309), R308 (= R316), P539 (= P544), P541 (= P546), C612 (= C620), M624 (= M632), D626 (= D634)
- binding magnesium ion: H370 (= H378), K373 (≠ R381), N378 (vs. gap), G379 (= G384), L381 (≠ H386), E430 (= E435), D458 (= D463)
6dkoA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2,6-f-phenyldiketoacid (see paper)
59% identity, 99% coverage: 2:726/729 of query aligns to 1:714/716 of 6dkoA
- active site: D270 (= D275), E272 (= E277), R332 (= R343), E424 (= E435), D452 (= D463), D622 (= D634)
- binding 4-(2,6-difluorophenyl)-2,4-dioxobutanoic acid: R332 (= R343), G449 (= G460), L451 (= L462), D452 (= D463), M505 (= M516), W531 (= W542), M620 (= M632), D622 (= D634)
- binding magnesium ion: E424 (= E435), D452 (= D463)
5c9rA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 3-((4-chlorophenyl)thio)propanoic acid (see paper)
59% identity, 99% coverage: 2:726/729 of query aligns to 1:715/717 of 5c9rA
- active site: D270 (= D275), E272 (= E277), R331 (= R343), E424 (= E435), D452 (= D463), D623 (= D634)
- binding 3-[(4-chlorophenyl)sulfanyl]propanoic acid: V117 (= V118), E424 (= E435), D452 (= D463), M505 (= M516), W531 (= W542), M621 (= M632), D623 (= D634)
- binding magnesium ion: E424 (= E435), D452 (= D463)
6bu1A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-br-3-oh-phenyldiketoacid (see paper)
59% identity, 99% coverage: 4:726/729 of query aligns to 2:710/712 of 6bu1A
- active site: D269 (= D275), E271 (= E277), R327 (= R343), E419 (= E435), D447 (= D463), D618 (= D634)
- binding (2Z)-4-(2-bromo-3-hydroxyphenyl)-2-hydroxy-4-oxobut-2-enoic acid: V116 (= V118), R327 (= R343), E419 (= E435), G444 (= G460), L446 (= L462), D447 (= D463), M500 (= M516), W526 (= W542), M616 (= M632), D618 (= D634)
- binding magnesium ion: E419 (= E435), D447 (= D463), V463 (= V479), R464 (= R480)
5cbiA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 5-chloro-2-hydroxybenzonitrile (see paper)
59% identity, 99% coverage: 2:726/729 of query aligns to 1:717/719 of 5cbiA
- active site: D270 (= D275), E272 (= E277), R331 (= R343), E426 (= E435), D454 (= D463), D625 (= D634)
- binding 5-chloro-2-hydroxybenzonitrile: L53 (= L54), N54 (≠ A55), D57 (= D58), F125 (≠ Y126), Y138 (= Y139), D139 (= D140), Y142 (= Y143), M507 (= M516), W533 (= W542), P535 (= P544), A611 (≠ C620), M623 (= M632), M623 (= M632), E624 (= E633), D625 (= D634)
- binding magnesium ion: E426 (= E435), D454 (= D463)
6axeA Crystal structure of a malate synthase g from mycobacterium marinum bound to acetyl coa
58% identity, 100% coverage: 1:726/729 of query aligns to 2:728/729 of 6axeA
- active site: D272 (= D275), E274 (= E277), R338 (= R343), E437 (= E435), D465 (= D463), D636 (= D634)
- binding acetyl coenzyme *a: V119 (= V118), V120 (= V119), R126 (= R125), F127 (≠ Y126), N130 (= N129), A131 (= A130), R311 (= R316), R338 (= R343), M518 (= M516), W544 (= W542), P546 (= P544), P548 (= P546), C622 (= C620), K624 (= K622), M634 (= M632), D636 (= D634)
- binding magnesium ion: E437 (= E435), D465 (= D463)
6dnpA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-f-3-methyl-6-f-phenyldiketoacid (see paper)
59% identity, 99% coverage: 2:726/729 of query aligns to 1:710/712 of 6dnpA
- active site: D270 (= D275), E272 (= E277), R328 (= R343), E419 (= E435), D447 (= D463), D618 (= D634)
- binding (2Z)-4-(2,6-difluoro-3-methylphenyl)-2-hydroxy-4-oxobut-2-enoic acid: R328 (= R343), E419 (= E435), G444 (= G460), L446 (= L462), D447 (= D463), M500 (= M516), W526 (= W542), M616 (= M632), D618 (= D634)
- binding magnesium ion: E419 (= E435), D447 (= D463)
5drcA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-hydroxy-4-(1h-indol-3-yl)-4-oxobut-2-enoic acid (see paper)
59% identity, 99% coverage: 2:726/729 of query aligns to 1:714/716 of 5drcA
- active site: D270 (= D275), E272 (= E277), R330 (= R343), E423 (= E435), D451 (= D463), D622 (= D634)
- binding (2Z)-2-hydroxy-4-(1H-indol-3-yl)-4-oxobut-2-enoic acid: R330 (= R343), E423 (= E435), G448 (= G460), L450 (= L462), D451 (= D463), M504 (= M516), W530 (= W542), M620 (= M632), D622 (= D634)
- binding magnesium ion: E423 (= E435), D451 (= D463), R468 (= R480), T471 (≠ D483)
5cakA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-hydroxy-3-(1h-indol-3-yl)propanoic acid (see paper)
59% identity, 99% coverage: 2:726/729 of query aligns to 1:715/717 of 5cakA
- active site: D270 (= D275), E272 (= E277), R329 (= R343), E424 (= E435), D452 (= D463), D623 (= D634)
- binding (2R)-2-hydroxy-3-(1H-indol-3-yl)propanoic acid: V117 (= V118), L451 (= L462), M505 (= M516), E622 (= E633), D623 (= D634)
- binding magnesium ion: E424 (= E435), D452 (= D463)
6c8pA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-f-phenyldiketoacid (see paper)
59% identity, 99% coverage: 2:726/729 of query aligns to 1:714/716 of 6c8pA
- active site: D270 (= D275), E272 (= E277), R329 (= R343), E423 (= E435), D451 (= D463), D622 (= D634)
- binding (2Z)-4-(2-fluorophenyl)-2-hydroxy-4-oxobut-2-enoic acid: R329 (= R343), E423 (= E435), G448 (= G460), L450 (= L462), D451 (= D463), M504 (= M516), W530 (= W542), M620 (= M632), D622 (= D634)
- binding magnesium ion: E423 (= E435), D451 (= D463)
5t8gA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-oxo-4-((thiophene-2-carbonyl)oxy)butanoic acid (see paper)
59% identity, 99% coverage: 2:726/729 of query aligns to 1:712/714 of 5t8gA
- active site: D270 (= D275), E272 (= E277), R328 (= R343), E421 (= E435), D449 (= D463), D620 (= D634)
- binding (3E)-2-oxo-4-[(thiophen-2-ylcarbonyl)oxy]but-3-enoic acid: V117 (= V118), R328 (= R343), E421 (= E435), G446 (= G460), L448 (= L462), D449 (= D463), M502 (= M516), W528 (= W542), E619 (= E633), D620 (= D634)
- binding magnesium ion: E421 (= E435), D449 (= D463), R466 (= R480), T469 (≠ D483)
5dx7A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 5-(5-chlorothiophen-2-yl)isoxazole-3-carboxylic acid (see paper)
59% identity, 99% coverage: 2:726/729 of query aligns to 1:712/714 of 5dx7A
- active site: D270 (= D275), E272 (= E277), R328 (= R343), E421 (= E435), D449 (= D463), D620 (= D634)
- binding 5-(5-chlorothiophen-2-yl)-1,2-oxazole-3-carboxylic acid: V117 (= V118), M502 (= M516), M618 (= M632), D620 (= D634)
- binding magnesium ion: E421 (= E435), D449 (= D463)
5c9uA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-(2-(2,4-dichlorophenyl)hydrazinyl)-2-oxoacetic acid (see paper)
59% identity, 99% coverage: 2:726/729 of query aligns to 1:712/714 of 5c9uA
- active site: D270 (= D275), E272 (= E277), R328 (= R343), E421 (= E435), D449 (= D463), D620 (= D634)
- binding [2-(2,4-dichlorophenyl)hydrazinyl](oxo)acetic acid: E421 (= E435), G446 (= G460), L448 (= L462), D449 (= D463), M502 (= M516), W528 (= W542), M618 (= M632), E619 (= E633), D620 (= D634)
- binding magnesium ion: E421 (= E435), D449 (= D463)
5cc3A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 6-bromo-1h-indole-2-carboxylic acid
59% identity, 99% coverage: 2:726/729 of query aligns to 1:713/715 of 5cc3A
- active site: D270 (= D275), E272 (= E277), R328 (= R343), E422 (= E435), D450 (= D463), D621 (= D634)
- binding 6-bromanyl-1H-indole-2-carboxylic acid: V117 (= V118), M503 (= M516), M619 (= M632), D621 (= D634)
- binding magnesium ion: E422 (= E435), D450 (= D463), V466 (= V479), R467 (= R480), T470 (≠ D483)
6dl9A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2,6-cl-phenyldiketoacid (see paper)
59% identity, 99% coverage: 2:726/729 of query aligns to 1:714/716 of 6dl9A
- active site: D270 (= D275), E272 (= E277), R328 (= R343), E423 (= E435), D451 (= D463), D622 (= D634)
- binding 4-(2,6-dichlorophenyl)-2,4-dioxobutanoic acid: V117 (= V118), R328 (= R343), E423 (= E435), G448 (= G460), L450 (= L462), D451 (= D463), M504 (= M516), W530 (= W542), M620 (= M632), D622 (= D634)
- binding magnesium ion: E423 (= E435), D451 (= D463)
5c9xA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2,4-dichloro-5-fluorobenzoic acid (see paper)
59% identity, 99% coverage: 2:726/729 of query aligns to 1:714/716 of 5c9xA
- active site: D270 (= D275), E272 (= E277), R328 (= R343), E423 (= E435), D451 (= D463), D622 (= D634)
- binding 2,4-dichloro-5-fluorobenzoic acid: V117 (= V118), S274 (= S279), R328 (= R343), M504 (= M516), W530 (= W542), M620 (= M632), D622 (= D634)
- binding magnesium ion: K295 (≠ R300), H363 (= H378), K366 (≠ R381), N371 (vs. gap), G372 (= G384), L374 (≠ H386), E423 (= E435), D451 (= D463)
5c7vA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 1h-pyrrole-2-carboxylic acid (see paper)
59% identity, 99% coverage: 2:726/729 of query aligns to 1:714/716 of 5c7vA
Query Sequence
>206126 MicrobesOnline__882:206126
MTGRIREGGLAVAEPLHRCIEREILPGTGISPSIFWAGLEELVGTLGPRNRELLARRDNM
QAAIDAWHKEHQGRPHDAAAYRRFLEDIRYLLPAPQDLAVETQGVDPEVATIAGPQLVVP
VTNPRYALNAVNARWGSLYDALYGSDVIADSDGAARGAAYNPLRGAKVVAYAAAFLDRTF
PLAGARHADVVRYELTGPPVGRKLSALCADGTVTGLLHPDAFAGYTGGERPTTVLLRNNG
LHVELQFDRRHPVGAAHPAGLKDVVLESAVTTILDCEDSVATVDAEDKALAYRNLLGLFR
GDLETSFDKGGRSVFRRLAADRTYTAPGGAAYALPGRSLMLVRNVGLLMTTDAVLDAAGQ
EIPEGILDGLVTACIGLHDLRGAGRHRNSGAGSVYIVKPKLHGPEEVAFVCEQFRRIEDI
LGMARNTLKMGVMDEERRTTLNLAECIRVASQRIIFINTGFLDRTGDEIHTCMEAGPVVR
KNDMKAQRWMLAYEDWNVDTGLAAGFGGKAQIGKGMWPKPDRLAEMVATKGAHPRAGANC
AWVPSPTAATLHALHYHEVDVFARQRELAGCHRASLDDLLALPLMGEARPSPAEVREELE
NNAQSILGYVVRWVEMGIGCSKVPDIHDVGLMEDRATLRISSQHIANWLRHGICTEDEVR
DVMLRMATVVDRQNKDEPGYRPMSADPGSSVAFRAACDLVFEGARQPNGYTEPILHARRR
EVKARSLTR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory