SitesBLAST
Comparing 206234 MicrobesOnline__882:206234 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3h0mA Structure of tRNA-dependent amidotransferase gatcab from aquifex aeolicus (see paper)
49% identity, 97% coverage: 4:479/489 of query aligns to 2:469/478 of 3h0mA
- active site: K72 (= K78), S147 (= S153), S148 (= S154), S166 (≠ T172), T168 (= T174), G169 (= G175), G170 (= G176), S171 (= S177), Q174 (= Q180)
- binding glutamine: M122 (= M128), G123 (= G129), D167 (= D173), T168 (= T174), G169 (= G175), G170 (= G176), S171 (= S177), F199 (≠ Y205), Y302 (= Y310), R351 (= R359), D418 (= D426)
3h0lA Structure of tRNA-dependent amidotransferase gatcab from aquifex aeolicus (see paper)
49% identity, 97% coverage: 4:479/489 of query aligns to 2:469/478 of 3h0lA
- active site: K72 (= K78), S147 (= S153), S148 (= S154), S166 (≠ T172), T168 (= T174), G169 (= G175), G170 (= G176), S171 (= S177), Q174 (= Q180)
- binding asparagine: G123 (= G129), S147 (= S153), G169 (= G175), G170 (= G176), S171 (= S177), Y302 (= Y310), R351 (= R359), D418 (= D426)
2f2aA Structure of tRNA-dependent amidotransferase gatcab complexed with gln (see paper)
49% identity, 95% coverage: 9:471/489 of query aligns to 12:468/485 of 2f2aA
- active site: K79 (= K78), S154 (= S153), S155 (= S154), S173 (≠ T172), T175 (= T174), G176 (= G175), G177 (= G176), S178 (= S177), Q181 (= Q180)
- binding glutamine: G130 (= G129), S154 (= S153), D174 (= D173), T175 (= T174), G176 (= G175), S178 (= S177), F206 (≠ Y205), Y309 (= Y310), Y310 (= Y311), R358 (= R359), D425 (= D426)
2dqnA Structure of tRNA-dependent amidotransferase gatcab complexed with asn (see paper)
49% identity, 95% coverage: 9:471/489 of query aligns to 12:468/485 of 2dqnA
- active site: K79 (= K78), S154 (= S153), S155 (= S154), S173 (≠ T172), T175 (= T174), G176 (= G175), G177 (= G176), S178 (= S177), Q181 (= Q180)
- binding asparagine: M129 (= M128), G130 (= G129), T175 (= T174), G176 (= G175), S178 (= S177), Y309 (= Y310), Y310 (= Y311), R358 (= R359), D425 (= D426)
3kfuE Crystal structure of the transamidosome (see paper)
51% identity, 92% coverage: 12:459/489 of query aligns to 5:437/468 of 3kfuE
4n0iA Crystal structure of s. Cerevisiae mitochondrial gatfab in complex with glutamine (see paper)
33% identity, 86% coverage: 48:469/489 of query aligns to 8:443/450 of 4n0iA
- active site: K38 (= K78), S116 (= S153), S117 (= S154), T135 (= T172), T137 (= T174), G138 (= G175), G139 (= G176), S140 (= S177), L143 (≠ Q180)
- binding glutamine: G89 (= G129), T137 (= T174), G138 (= G175), S140 (= S177), Y168 (= Y205), Y271 (= Y310), Y272 (= Y311), R320 (= R359), D404 (= D426)
Q7XJJ7 Fatty acid amide hydrolase; AtFAAH; N-acylethanolamine amidohydrolase; EC 3.5.1.99 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
33% identity, 92% coverage: 38:486/489 of query aligns to 163:598/607 of Q7XJJ7
- K205 (= K78) mutation to A: Loss of activity.
- SS 281:282 (= SS 153:154) mutation to AA: Loss of activity.
- GGGS 302:305 (≠ TGGS 174:177) binding
- S305 (= S177) mutation to A: Loss of activity.
- R307 (= R179) mutation to A: Loss of activity.
- S360 (≠ H232) mutation to A: No effect.
6diiH Structure of arabidopsis fatty acid amide hydrolase in complex with methyl linolenyl fluorophosphonate (see paper)
33% identity, 92% coverage: 38:486/489 of query aligns to 163:598/616 of 6diiH
- binding methyl-9Z,12Z,15Z-octadecatrienylphosphonofluoridate: G255 (≠ A127), T258 (≠ S130), S281 (= S153), G302 (≠ T174), G303 (= G175), S305 (= S177), S472 (≠ L343), I532 (≠ M422), M539 (≠ D426)
Sites not aligning to the query:
3a1iA Crystal structure of rhodococcus sp. N-771 amidase complexed with benzamide (see paper)
36% identity, 87% coverage: 64:486/489 of query aligns to 81:507/508 of 3a1iA
- active site: K95 (= K78), S170 (= S153), S171 (= S154), G189 (≠ T172), Q191 (≠ T174), G192 (= G175), G193 (= G176), A194 (≠ S177), I197 (≠ Q180)
- binding benzamide: F145 (≠ M128), S146 (≠ G129), G147 (≠ S130), Q191 (≠ T174), G192 (= G175), G193 (= G176), A194 (≠ S177), W327 (≠ Y310)
6c6gA An unexpected vestigial protein complex reveals the evolutionary origins of an s-triazine catabolic enzyme. Inhibitor bound complex. (see paper)
35% identity, 96% coverage: 7:476/489 of query aligns to 1:448/457 of 6c6gA
1m21A Crystal structure analysis of the peptide amidase pam in complex with the competitive inhibitor chymostatin (see paper)
34% identity, 91% coverage: 25:471/489 of query aligns to 27:471/487 of 1m21A
- active site: K81 (= K78), S160 (= S153), S161 (= S154), T179 (= T172), T181 (= T174), D182 (≠ G175), G183 (= G176), S184 (= S177), C187 (≠ Q180)
- binding : A129 (= A127), N130 (≠ M128), F131 (≠ G129), C158 (≠ G151), G159 (= G152), S160 (= S153), S184 (= S177), C187 (≠ Q180), I212 (≠ Y205), R318 (≠ S320), L321 (≠ A323), L365 (≠ V366), F426 (vs. gap)
Q84DC4 Mandelamide hydrolase; EC 3.5.1.86 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
30% identity, 97% coverage: 4:479/489 of query aligns to 25:490/507 of Q84DC4
- T31 (≠ A10) mutation to I: More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with N-437.
- K100 (= K78) mutation to A: Abolishes activity on mandelamide.
- S180 (= S153) mutation to A: Significantly decreases activity on mandelamide.
- S181 (= S154) mutation to A: Significantly decreases activity on mandelamide.
- G202 (= G175) mutation to A: Increase in KM values for aromatic substrates, but not aliphatic substrates. Active against lactamide but not against mandelamide; when associated with H-207 and E-382.; mutation to V: Increase in KM values for aromatic substrates, but not aliphatic substrates.
- S204 (= S177) mutation to A: Abolishes activity on mandelamide.
- Q207 (= Q180) mutation to H: Increases activity on lactamide, does not affect activity on mandelamide; when associated with E-382. Active against lactamide but not against mandelamide; when associated with A-202 and E-382. More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with S-316 and N-437.
- S316 (= S306) mutation to N: More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with H-207 and N-437.
- Q382 (≠ D373) mutation to H: Increases activity on lactamide, does not affect activity on mandelamide; when associated with H-207. Active against lactamide but not against mandelamide; when associated with A-202 and H-207.
- I437 (≠ S431) mutation to N: More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers. More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with I-31. More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with H-207 and N-316.
5h6sC Crystal structure of hydrazidase s179a mutant complexed with a substrate (see paper)
28% identity, 97% coverage: 7:480/489 of query aligns to 5:448/457 of 5h6sC
- active site: K77 (= K78), S152 (= S153), S153 (= S154), L173 (≠ T174), G174 (= G175), G175 (= G176), S176 (= S177)
- binding 4-oxidanylbenzohydrazide: C126 (≠ A127), R128 (≠ G129), W129 (≠ S130), S152 (= S153), L173 (≠ T174), G174 (= G175), S176 (= S177), W306 (≠ Y310), F338 (≠ L362)
Q936X2 Allophanate hydrolase; EC 3.5.1.54 from Pseudomonas sp. (strain ADP) (see paper)
32% identity, 92% coverage: 25:475/489 of query aligns to 37:460/605 of Q936X2
- K91 (= K78) mutation to A: Loss of activity.
- S165 (= S153) mutation to A: Loss of activity.
- S189 (= S177) mutation to A: Loss of activity.
4gysB Granulibacter bethesdensis allophanate hydrolase co-crystallized with malonate (see paper)
33% identity, 88% coverage: 50:481/489 of query aligns to 45:443/461 of 4gysB
- active site: K72 (= K78), S146 (= S153), S147 (= S154), T165 (= T172), T167 (= T174), A168 (≠ G175), G169 (= G176), S170 (= S177), V173 (≠ Q180)
- binding malonate ion: A120 (= A127), G122 (= G129), S146 (= S153), T167 (= T174), A168 (≠ G175), S170 (= S177), S193 (≠ Y200), G194 (= G201), V195 (≠ L202), R200 (≠ S207), Y297 (= Y325), R305 (= R333)
4yjiA The crystal structure of a bacterial aryl acylamidase belonging to the amidase signature (as) enzymes family (see paper)
29% identity, 98% coverage: 2:480/489 of query aligns to 1:477/490 of 4yjiA
- active site: K79 (= K78), S158 (= S153), S159 (= S154), G179 (≠ T174), G180 (= G175), G181 (= G176), A182 (≠ S177)
- binding n-(4-hydroxyphenyl)acetamide (tylenol): L81 (≠ A80), G132 (≠ A127), S158 (= S153), G179 (≠ T174), G180 (= G175), A182 (≠ S177)
3a2qA Structure of 6-aminohexanoate cyclic dimer hydrolase complexed with substrate (see paper)
35% identity, 48% coverage: 31:264/489 of query aligns to 29:259/482 of 3a2qA
- active site: K69 (= K78), S147 (= S153), S148 (= S154), N166 (≠ T172), A168 (≠ T174), A169 (≠ G175), G170 (= G176), A171 (≠ S177), I174 (≠ Q180)
- binding 6-aminohexanoic acid: G121 (≠ A127), G121 (≠ A127), N122 (≠ M128), S147 (= S153), A168 (≠ T174), A168 (≠ T174), A169 (≠ G175), A171 (≠ S177)
Sites not aligning to the query:
1o9oA Crystal structure of the s131a mutant of malonamidase e2 complexed with malonamate from bradyrhizobium japonicum (see paper)
29% identity, 92% coverage: 29:479/489 of query aligns to 6:410/412 of 1o9oA
- active site: K62 (= K78), A131 (≠ S153), S132 (= S154), T150 (= T172), T152 (= T174), G153 (= G175), G154 (= G176), S155 (= S177), R158 (≠ Q180)
- binding 3-amino-3-oxopropanoic acid: G130 (= G152), T152 (= T174), G153 (= G175), G154 (= G176), S155 (= S177), R158 (≠ Q180), P359 (= P419)
1ocmA The crystal structure of malonamidase e2 covalently complexed with pyrophosphate from bradyrhizobium japonicum (see paper)
29% identity, 92% coverage: 29:479/489 of query aligns to 6:410/412 of 1ocmA
- active site: K62 (= K78), S131 (= S153), S132 (= S154), T152 (= T174), G153 (= G175), G154 (= G176), S155 (= S177)
- binding pyrophosphate 2-: R113 (≠ G129), S131 (= S153), Q151 (≠ D173), T152 (= T174), G153 (= G175), G154 (= G176), S155 (= S177), R158 (≠ Q180), P359 (= P419)
4hbpA Crystal structure of faah in complex with inhibitor (see paper)
39% identity, 31% coverage: 70:220/489 of query aligns to 92:246/531 of 4hbpA
- active site: K100 (= K78), S175 (= S153), S176 (= S154), T194 (= T172), I196 (≠ T174), G197 (= G175), G198 (= G176), S199 (= S177), F202 (≠ Q180)
- binding 4-(3-phenyl-1,2,4-thiadiazol-5-yl)-N-(pyridin-3-yl)piperazine-1-carboxamide: S151 (≠ G129), F152 (≠ S130), I196 (≠ T174), G197 (= G175), S199 (= S177)
Sites not aligning to the query:
Query Sequence
>206234 MicrobesOnline__882:206234
MSALHTLSLAAIRDALARREVRAEDAVLDCLARIETTEPRIDALLHLRAEAAIEEARALD
AAGPDASRPLWGVPVTVKDALTTAGTPTTAGSRILEDFVPFYDAFAVQRLREAGAIILGK
NNMDEFAMGSSTENSAYKPTRNPWDTARVPGGSSGGSAASVAAGQCFASLGTDTGGSIRQ
PASLCGCVGLKPTYGRVSRYGLIAYGSSLDQIGPMTRTVEDAAIVMGVIAGHDKRDSTCA
DRPVEDFAAALASRHDLAGVRIGVPAEFWGEGLSPEVATSCRAALDAARDLGATIVDVAL
PHTPQSIAAYYIVASAEASSNLARYDGVRYGKRAHAPEDLMDLYVRSRSEGLGDEVQRRI
MLGTYVLSSGYYDAYYRKAAQVRRRILEDYRNAFATCDVICGPVSPVTAWPLGALTADPL
QMYLMDVFTLSLNLAGLPGLSLPVGLGTESGMPVGIQLLGRSFDEATLLSVGNVLSRALP
PLGSPAGLR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory