Comparing 206235 MicrobesOnline__882:206235 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
3al0C Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
36% identity, 98% coverage: 2:93/94 of query aligns to 1:92/564 of 3al0C
Sites not aligning to the query:
>206235 MicrobesOnline__882:206235
MKISKEQVATIARLARLDLDEARLERFAGQFGDILDYMDMLGAVDTTDVEPLYSPSEHGT
VLRADEVHTHCTREELLANAPESDGQFFVVPRIV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory