SitesBLAST
Comparing 206254 MicrobesOnline__882:206254 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
35% identity, 88% coverage: 54:469/471 of query aligns to 45:462/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P82), G75 (≠ A84), S76 (≠ R85), G77 (≠ A86), T78 (= T87), G79 (≠ N88), L80 (≠ V89), A83 (≠ G92), C84 (= C93), P137 (= P146), G138 (≠ A147), E139 (≠ S148), A142 (≠ S152), T143 (≠ S153), G146 (= G156), N147 (= N157), S149 (≠ A159), T150 (= T160), A152 (= A162), G153 (= G163), E203 (= E213), G204 (= G214), I209 (≠ L219), E422 (= E429), H423 (= H430)
- binding fe (iii) ion: H377 (= H385), H384 (= H392), E422 (= E429)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 89% coverage: 54:471/471 of query aligns to 40:456/459 of P9WIT1
- K354 (≠ E364) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
34% identity, 90% coverage: 44:469/471 of query aligns to 29:453/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R336), W322 (≠ N340), H369 (= H385), H376 (= H392), H414 (= H430)
- binding flavin-adenine dinucleotide: P68 (= P82), G70 (≠ A84), T71 (≠ R85), G72 (≠ A86), T73 (= T87), G74 (≠ N88), G78 (= G92), V79 (≠ C93), L90 (≠ T104), P132 (= P146), G133 (≠ A147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (= A159), T144 (= T160), A146 (= A162), S147 (≠ G163), E200 (= E213), G201 (= G214), I206 (≠ L219), W322 (≠ N340), E413 (= E429), N450 (= N466)
- binding manganese (ii) ion: H369 (= H385), H376 (= H392), E413 (= E429)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
34% identity, 90% coverage: 44:469/471 of query aligns to 29:453/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P82), G70 (≠ A84), T71 (≠ R85), G72 (≠ A86), T73 (= T87), G74 (≠ N88), G78 (= G92), V79 (≠ C93), L90 (≠ T104), P132 (= P146), G133 (≠ A147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (= A159), T144 (= T160), A146 (= A162), S147 (≠ G163), E200 (= E213), G201 (= G214), I206 (≠ L219), W322 (≠ N340), E413 (= E429), H414 (= H430), N450 (= N466)
- binding lactic acid: R318 (= R336), H369 (= H385), H376 (= H392), H414 (= H430)
- binding manganese (ii) ion: H369 (= H385), H376 (= H392), E413 (= E429)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
34% identity, 90% coverage: 44:469/471 of query aligns to 29:453/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R336), H369 (= H385), H376 (= H392), H414 (= H430)
- binding flavin-adenine dinucleotide: P68 (= P82), G70 (≠ A84), T71 (≠ R85), G72 (≠ A86), T73 (= T87), G74 (≠ N88), G78 (= G92), V79 (≠ C93), L90 (≠ T104), P132 (= P146), G133 (≠ A147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (= A159), T144 (= T160), A146 (= A162), S147 (≠ G163), E200 (= E213), G201 (= G214), I206 (≠ L219), W322 (≠ N340), E413 (= E429), H414 (= H430), N450 (= N466)
- binding manganese (ii) ion: H369 (= H385), H376 (= H392), E413 (= E429)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
34% identity, 90% coverage: 44:469/471 of query aligns to 29:454/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (≠ A47), P68 (= P82), G70 (≠ A84), T71 (≠ R85), G72 (≠ A86), T73 (= T87), G74 (≠ N88), G78 (= G92), V79 (≠ C93), L90 (≠ T104), P132 (= P146), G133 (≠ A147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (= A159), T144 (= T160), A146 (= A162), S147 (≠ G163), E200 (= E213), G201 (= G214), I206 (≠ L219), W323 (≠ N340), E414 (= E429), H415 (= H430), N451 (= N466)
- binding manganese (ii) ion: H370 (= H385), H377 (= H392), E414 (= E429)
- binding pyruvic acid: R319 (= R336), H370 (= H385), H377 (= H392), H415 (= H430)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
34% identity, 90% coverage: 44:469/471 of query aligns to 29:452/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (= V89), R317 (= R336), W321 (≠ N340), H368 (= H385), H375 (= H392), H413 (= H430)
- binding flavin-adenine dinucleotide: P68 (= P82), G70 (≠ A84), T71 (≠ R85), G72 (≠ A86), T73 (= T87), G74 (≠ N88), G78 (= G92), V79 (≠ C93), L90 (≠ T104), P132 (= P146), G133 (≠ A147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (= A159), T144 (= T160), A146 (= A162), S147 (≠ G163), E200 (= E213), G201 (= G214), I206 (≠ L219), W321 (≠ N340), Y322 (≠ P341), E412 (= E429), H413 (= H430), N449 (= N466)
- binding manganese (ii) ion: H368 (= H385), H375 (= H392), E412 (= E429)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
34% identity, 90% coverage: 44:469/471 of query aligns to 29:453/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (= P82), G70 (≠ A84), T71 (≠ R85), G72 (≠ A86), T73 (= T87), G74 (≠ N88), G78 (= G92), V79 (≠ C93), L90 (≠ T104), P132 (= P146), G133 (≠ A147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (= A159), T144 (= T160), A146 (= A162), S147 (≠ G163), E200 (= E213), G201 (= G214), I206 (≠ L219), H369 (= H385), E413 (= E429), N450 (= N466)
- binding deaminohydroxyvaline: R319 (= R336), H414 (= H430)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
34% identity, 90% coverage: 44:469/471 of query aligns to 29:453/455 of 8jdxA
- binding flavin-adenine dinucleotide: E32 (≠ A47), P68 (= P82), G70 (≠ A84), T71 (≠ R85), G72 (≠ A86), T73 (= T87), G74 (≠ N88), G78 (= G92), V79 (≠ C93), L90 (≠ T104), P132 (= P146), G133 (≠ A147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (= A159), T144 (= T160), A146 (= A162), S147 (≠ G163), E200 (= E213), G201 (= G214), I206 (≠ L219), W322 (≠ N340), E413 (= E429), H414 (= H430), N450 (= N466)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R336), H369 (= H385), H376 (= H392), H414 (= H430)
- binding manganese (ii) ion: H369 (= H385), H376 (= H392), E413 (= E429)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
34% identity, 90% coverage: 44:469/471 of query aligns to 29:454/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P82), G70 (≠ A84), T71 (≠ R85), G72 (≠ A86), T73 (= T87), G74 (≠ N88), G78 (= G92), V79 (≠ C93), L90 (≠ T104), P132 (= P146), G133 (≠ A147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (= A159), T144 (= T160), A146 (= A162), S147 (≠ G163), E200 (= E213), G201 (= G214), I206 (≠ L219), Y324 (≠ P341), H370 (= H385), E414 (= E429), N451 (= N466)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R336), W323 (≠ N340), H415 (= H430)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
34% identity, 90% coverage: 44:469/471 of query aligns to 29:454/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R336), W323 (≠ N340), H370 (= H385), H415 (= H430)
- binding flavin-adenine dinucleotide: P68 (= P82), G70 (≠ A84), T71 (≠ R85), G72 (≠ A86), T73 (= T87), G74 (≠ N88), G78 (= G92), V79 (≠ C93), L90 (≠ T104), P132 (= P146), G133 (≠ A147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (= A159), T144 (= T160), A146 (= A162), S147 (≠ G163), E200 (= E213), G201 (= G214), I206 (≠ L219), H370 (= H385), E414 (= E429), N451 (= N466)
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
34% identity, 90% coverage: 44:469/471 of query aligns to 29:454/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R336), W323 (≠ N340), H415 (= H430)
- binding flavin-adenine dinucleotide: P68 (= P82), G70 (≠ A84), T71 (≠ R85), G72 (≠ A86), T73 (= T87), G74 (≠ N88), G78 (= G92), V79 (≠ C93), L90 (≠ T104), P132 (= P146), G133 (≠ A147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (= A159), T144 (= T160), A146 (= A162), S147 (≠ G163), E200 (= E213), G201 (= G214), I206 (≠ L219), Y324 (≠ P341), H370 (= H385), E414 (= E429), N451 (= N466)
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
34% identity, 90% coverage: 44:469/471 of query aligns to 29:454/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (= P82), G70 (≠ A84), T71 (≠ R85), G72 (≠ A86), T73 (= T87), G74 (≠ N88), G78 (= G92), V79 (≠ C93), L90 (≠ T104), P132 (= P146), G133 (≠ A147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (= A159), T144 (= T160), A146 (= A162), S147 (≠ G163), E200 (= E213), G201 (= G214), I206 (≠ L219), H370 (= H385), E414 (= E429), N451 (= N466)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R336), W323 (≠ N340), H415 (= H430)
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
34% identity, 90% coverage: 44:469/471 of query aligns to 29:454/456 of 8jdgA
- binding flavin-adenine dinucleotide: P68 (= P82), G70 (≠ A84), T71 (≠ R85), G72 (≠ A86), T73 (= T87), G74 (≠ N88), G78 (= G92), V79 (≠ C93), L90 (≠ T104), P132 (= P146), G133 (≠ A147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (= A159), T144 (= T160), A146 (= A162), S147 (≠ G163), E200 (= E213), G201 (= G214), I206 (≠ L219), H370 (= H385), E414 (= E429), N451 (= N466)
- binding (2R)-2-oxidanylbutanoic acid: R319 (= R336), H415 (= H430)
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
34% identity, 90% coverage: 44:469/471 of query aligns to 29:454/456 of 8jdbA
- binding flavin-adenine dinucleotide: P68 (= P82), G70 (≠ A84), T71 (≠ R85), G72 (≠ A86), T73 (= T87), G74 (≠ N88), G78 (= G92), V79 (≠ C93), L90 (≠ T104), P132 (= P146), G133 (≠ A147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (= A159), T144 (= T160), A146 (= A162), S147 (≠ G163), E200 (= E213), G201 (= G214), I206 (≠ L219), Y324 (≠ P341), H370 (= H385), E414 (= E429), N451 (= N466)
- binding (2R)-2-oxidanyloctanoic acid: V75 (= V89), R319 (= R336), W323 (≠ N340), H415 (= H430)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
34% identity, 90% coverage: 44:469/471 of query aligns to 29:452/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R336), W322 (≠ N340), H369 (= H385), H376 (= H392), H413 (= H430)
- binding flavin-adenine dinucleotide: E32 (≠ A47), P68 (= P82), G70 (≠ A84), T71 (≠ R85), G72 (≠ A86), T73 (= T87), G74 (≠ N88), G78 (= G92), V79 (≠ C93), L90 (≠ T104), P132 (= P146), G133 (≠ A147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (= A159), T144 (= T160), A146 (= A162), S147 (≠ G163), E200 (= E213), G201 (= G214), I206 (≠ L219), W322 (≠ N340), E412 (= E429), H413 (= H430), N449 (= N466)
- binding manganese (ii) ion: H369 (= H385), H376 (= H392), E412 (= E429)
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
34% identity, 90% coverage: 44:469/471 of query aligns to 29:452/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R336), W322 (≠ N340), S336 (= S352), H369 (= H385), H376 (= H392), H413 (= H430)
- binding flavin-adenine dinucleotide: P68 (= P82), G70 (≠ A84), T71 (≠ R85), G72 (≠ A86), T73 (= T87), G74 (≠ N88), G78 (= G92), V79 (≠ C93), L90 (≠ T104), P132 (= P146), G133 (≠ A147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (= A159), T144 (= T160), A146 (= A162), S147 (≠ G163), E200 (= E213), G201 (= G214), I206 (≠ L219), E412 (= E429), N449 (= N466)
- binding manganese (ii) ion: H369 (= H385), H376 (= H392), E412 (= E429)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
33% identity, 89% coverage: 53:469/471 of query aligns to 41:463/465 of 3pm9A
- active site: A149 (= A162), L159 (≠ V172)
- binding flavin-adenine dinucleotide: P69 (= P82), Q70 (≠ R83), G71 (≠ A84), G72 (≠ R85), N73 (≠ A86), T74 (= T87), G75 (≠ N88), L76 (≠ V89), G79 (= G92), Q80 (≠ C93), L91 (≠ T104), L133 (≠ P146), G134 (≠ A147), A135 (≠ S148), C139 (≠ S152), T140 (≠ S153), G142 (= G155), G143 (= G156), S146 (≠ A159), T147 (= T160), A149 (= A162), G150 (= G163), E200 (= E213), G201 (= G214), I205 (≠ C218), I206 (≠ L219), E423 (= E429)
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
30% identity, 92% coverage: 38:469/471 of query aligns to 51:494/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
31% identity, 89% coverage: 52:469/471 of query aligns to 45:462/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R336), T337 (≠ N340), K348 (= K347), Y379 (≠ F383), H381 (= H385), H388 (= H392), H423 (= H430)
- binding flavin-adenine dinucleotide: P75 (= P82), Q76 (≠ R83), G77 (≠ A84), G78 (≠ R85), N79 (≠ A86), T80 (= T87), G81 (≠ N88), M82 (≠ V89), G85 (= G92), S86 (≠ C93), L139 (≠ P146), G140 (≠ A147), A141 (≠ S148), C145 (≠ S152), G149 (= G156), N150 (= N157), A152 (= A159), T153 (= T160), G157 (= G164), G207 (= G214), I212 (≠ L219), E422 (= E429), N459 (= N466)
- binding zinc ion: H381 (= H385), H388 (= H392), E422 (= E429)
Sites not aligning to the query:
Query Sequence
>206254 MicrobesOnline__882:206254
MSHTANVTAEEAVHGLSAAQRRFLEGLLPEGDRLFSAEETLVFGTDASRKCGTPLAVVRP
TTEAQVVELLRWADAERLPVYPRARATNVVGGCVPQRPGIVLSTLRMARIIDIDEHDFVA
VVQPGVITADLQRAVEARGLFYPPDPASQNISSIGGNVATCAGGMRAVRYGVTRDYVLGL
RAVLPGGEVLATGSRCHKNVVGLDLVRLLVGSEGTLGCLTEVTLKLLPLPEATASLLAGF
SDLGAAMDAVRNVFAAGILPVALEFMGPEVLDCAALLNDVPWPKTVRAALLFRLDGSRAA
LPLEVDRLAAAVRDAAPVWSAVGVGRDEEEPLWTIRRSINPASFLVKPDKMSDDVTVPRG
RLREALEGIRAIAEARSLTILTFGHVGDGNIHVNIMHDASVTEEREHALAAKGEVTDLIL
SLGGTLSGEHGVGLTKAPYVHRQLSKLERGLMAQVKAAFDPHGIMNPGKAY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory