Comparing 206268 DVU0841 aspartate aminotransferase, putative to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3eleA Crystal structure of amino transferase (rer070207001803) from eubacterium rectale at 2.10 a resolution
39% identity, 95% coverage: 16:390/393 of query aligns to 16:391/398 of 3eleA
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
34% identity, 92% coverage: 28:390/393 of query aligns to 26:380/382 of 1gc4A
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
34% identity, 92% coverage: 28:390/393 of query aligns to 26:380/382 of 1gc3A
Sites not aligning to the query:
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
34% identity, 92% coverage: 28:390/393 of query aligns to 26:380/382 of 1b5oA
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
34% identity, 93% coverage: 28:393/393 of query aligns to 26:383/385 of Q56232
Sites not aligning to the query:
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
34% identity, 92% coverage: 28:390/393 of query aligns to 26:380/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
34% identity, 92% coverage: 28:390/393 of query aligns to 26:380/382 of 1bjwA
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
35% identity, 92% coverage: 31:390/393 of query aligns to 34:377/384 of 1o4sB
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
30% identity, 91% coverage: 37:392/393 of query aligns to 37:392/402 of P14909
Sites not aligning to the query:
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
29% identity, 96% coverage: 15:390/393 of query aligns to 11:380/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
29% identity, 96% coverage: 15:390/393 of query aligns to 11:380/388 of 1gd9A
1j32A Aspartate aminotransferase from phormidium lapideum
27% identity, 90% coverage: 37:390/393 of query aligns to 32:382/388 of 1j32A
Q02635 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.79 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
30% identity, 89% coverage: 43:390/393 of query aligns to 39:394/400 of Q02635
Sites not aligning to the query:
6f77A Crystal structure of the prephenate aminotransferase from rhizobium meliloti (see paper)
30% identity, 89% coverage: 43:390/393 of query aligns to 38:393/399 of 6f77A
1xi9C Alanine aminotransferase from pyrococcus furiosus pfu-1397077-001
28% identity, 90% coverage: 38:390/393 of query aligns to 9:388/393 of 1xi9C
P0A959 Glutamate-pyruvate aminotransferase AlaA; EC 2.6.1.2 from Escherichia coli (strain K12) (see paper)
30% identity, 86% coverage: 35:373/393 of query aligns to 33:380/405 of P0A959
4cvqA Crystal structure of an aminotransferase from escherichia coli at 2. 11 angstroem resolution (see paper)
30% identity, 86% coverage: 35:373/393 of query aligns to 33:380/404 of 4cvqA
Q58097 (5-formylfuran-3-yl)methyl phosphate transaminase; 4-HFC-P:alanine aminotransferase; EC 2.6.1.108 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
25% identity, 91% coverage: 37:392/393 of query aligns to 31:365/370 of Q58097
P58350 Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
29% identity, 88% coverage: 43:386/393 of query aligns to 49:400/410 of P58350
8wkjA The crystal structure of aspartate aminotransferases lpg0070 from legionella pneumophila (see paper)
26% identity, 89% coverage: 43:390/393 of query aligns to 39:388/391 of 8wkjA
>206268 DVU0841 aspartate aminotransferase, putative
MSLLSQQISGYMERASWIRKMFEAGIILKQQYGEDAVCDFSLGNPDLPAPAAVGDGLRAM
ADRAGEPFAFGYMPNGGYAWARQKLATHLSAEQGVSLTGDDVVLTCGAAGGLNAFFRAVL
DEGDEVLSMAPYFVEYGFYVENHGGVFRTVKTLPDTFGLDLDAIELAMTPRTRAVIINSP
NNPTGAVYSRAELEGLADILARASARNGRPVFLIADEPYRFLAFDGAEVPSVLPLYDHSL
VVSSFSKNLSLAGERLGYIALSPRMENRGKLAAGLLLTNRILGFVNPPVVGQHIMAAALG
AQVDASIYARRRDVMAEVLTEAGYDFQMPRGAFYFFPKAPGGDDVTFVSRLMEERILAVP
GSGFGGPGHFRLTFCVDETIIRRAAEGFRRARG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory