SitesBLAST
Comparing 206318 MicrobesOnline__882:206318 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
Q5F8J4 NAD(+)-dependent homoserine dehydrogenase; NAD(+)-dependent HSD; NgHSD; EC 1.1.1.3 from Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) (see paper)
44% identity, 96% coverage: 1:408/424 of query aligns to 1:415/435 of Q5F8J4
- L45 (≠ R45) mutation to R: Shows a marked increase in the catalytic efficiency with NADP(+).
- LS 45:46 (≠ RD 45:46) mutation to RD: Does not impair the catalytic activity with NAD(+). Slightly increases the activity, but slightly decreases the affinity for NADP(+).; mutation to RR: Causes a shift in coenzyme preference from NAD(+) to NADP(+) by a factor of 974. Shows a slight decrease in the catalytic efficiency with NAD(+) and a 4.5-fold increase in catalytic efficiency with NADP(+).
6dzsA Mycobacterial homoserine dehydrogenase thra in complex with NADP
40% identity, 96% coverage: 2:408/424 of query aligns to 3:413/431 of 6dzsA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G10), L12 (≠ C11), G13 (= G12), N14 (≠ T13), V15 (= V14), V45 (= V44), R46 (= R45), R47 (≠ D46), R52 (= R51), I63 (≠ P63), L78 (= L78), M79 (= M79), P84 (≠ K84), A102 (= A102), K104 (= K104), G306 (= G301), T310 (= T305)
4pg7A Crystal structure of s. Aureus homoserine dehydrogenase at ph7.5 (see paper)
44% identity, 76% coverage: 1:323/424 of query aligns to 2:317/402 of 4pg7A
Sites not aligning to the query:
6a0sA Homoserine dehydrogenase from thermus thermophilus hb8 complexed with hse and NADPH (see paper)
41% identity, 76% coverage: 1:323/424 of query aligns to 1:312/331 of 6a0sA
- active site: D191 (= D200), K195 (= K204)
- binding l-homoserine: K99 (= K104), N150 (= N158), G151 (= G159), T152 (= T160), Y178 (= Y187), E180 (= E189), D186 (= D195), K195 (= K204)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (≠ C11), G12 (= G12), T13 (= T13), V14 (= V14), L42 (= L43), V43 (= V44), R44 (= R45), D45 (= D46), K48 (= K49), R50 (= R51), A73 (≠ L78), M74 (= M79), A97 (= A102), K99 (= K104), G177 (= G186), E180 (= E189), A289 (= A300), G290 (= G301), T294 (= T305)
2ejwA Homoserine dehydrogenase from thermus thermophilus hb8
41% identity, 76% coverage: 1:323/424 of query aligns to 1:312/331 of 2ejwA
6a0tB Homoserine dehydrogenase k99a mutant from thermus thermophilus hb8 complexed with hse and NADP+ (see paper)
41% identity, 76% coverage: 1:323/424 of query aligns to 1:312/332 of 6a0tB
- active site: D191 (= D200), K195 (= K204)
- binding l-homoserine: N150 (= N158), G151 (= G159), T152 (= T160), Y178 (= Y187), E180 (= E189), D186 (= D195), K195 (= K204)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G10), G11 (≠ C11), G12 (= G12), T13 (= T13), V14 (= V14), L42 (= L43), V43 (= V44), R44 (= R45), D45 (= D46), K48 (= K49), R50 (= R51), A73 (≠ L78), M74 (= M79), G75 (= G80), A97 (= A102), N98 (= N103), G177 (= G186), E180 (= E189), A289 (= A300), G290 (= G301), T294 (= T305)
7f4cA The crystal structure of the immature holo-enzyme of homoserine dehydrogenase complexed with NADP and 1,4-butandiol from the hyperthermophilic archaeon sulfurisphaera tokodaii. (see paper)
31% identity, 73% coverage: 8:318/424 of query aligns to 5:297/300 of 7f4cA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: F6 (≠ A9), G7 (= G10), Y8 (≠ C11), G9 (= G12), N10 (≠ T13), V11 (= V14), T37 (≠ E31), R38 (= R32), R39 (≠ T33), V72 (= V74), S73 (≠ L75), S74 (≠ V76), T100 (≠ A102), K102 (= K104), G127 (≠ A129), S131 (≠ G133), E185 (= E189), G280 (= G301), A284 (≠ T305)
5x9dA Crystal structure of homoserine dehydrogenase in complex with l- cysteine and NAD (see paper)
31% identity, 73% coverage: 8:318/424 of query aligns to 5:299/302 of 5x9dA
- active site: D196 (= D200), K200 (= K204)
- binding (2R)-3-[[(4S)-3-aminocarbonyl-1-[(2R,3R,4S,5R)-5-[[[[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxymethyl]-3,4-bis(oxidanyl)oxolan-2-yl]-4H-pyridin-4-yl]sulfanyl]-2-azanyl-propanoic acid: F6 (≠ A9), G7 (= G10), Y8 (≠ C11), G9 (= G12), N10 (≠ T13), V11 (= V14), T37 (≠ E31), R38 (= R32), V72 (= V74), S73 (≠ L75), S74 (≠ V76), P82 (≠ K84), T100 (≠ A102), N101 (= N103), K102 (= K104), G127 (≠ A129), S131 (≠ G133), N155 (= N158), G156 (= G159), T157 (= T160), Y183 (= Y187), A184 (= A188), E185 (= E189), D191 (= D195), D196 (= D200), K200 (= K204), A281 (= A300), G282 (= G301), A286 (≠ T305)
4xb2A Hyperthermophilic archaeal homoserine dehydrogenase mutant in complex with NADPH (see paper)
29% identity, 75% coverage: 6:321/424 of query aligns to 5:316/319 of 4xb2A
- active site: D211 (= D200), K215 (= K204)
- binding l-homoserine: A171 (≠ G159), S172 (≠ T160), D206 (= D195), K215 (= K204)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: F8 (≠ A9), F10 (≠ C11), G11 (= G12), T12 (= T13), V13 (= V14), R40 (= R32), V91 (≠ L78), S92 (≠ G80), S93 (≠ G81), S114 (≠ A102), N115 (= N103), K116 (= K104), S141 (≠ A129), G295 (≠ A300), T300 (= T305)
4xb1A Hyperthermophilic archaeal homoserine dehydrogenase in complex with NADPH (see paper)
29% identity, 75% coverage: 6:321/424 of query aligns to 5:316/319 of 4xb1A
- active site: D211 (= D200), K215 (= K204)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: F8 (≠ A9), F10 (≠ C11), G11 (= G12), T12 (= T13), V13 (= V14), D39 (≠ E31), R40 (= R32), K57 (= K40), V91 (≠ L78), S92 (≠ G80), S93 (≠ G81), S114 (≠ A102), K116 (= K104), S141 (≠ A129), G295 (≠ A300), T300 (= T305)
3ingA Crystal structure of homoserine dehydrogenase (np_394635.1) from thermoplasma acidophilum at 1.95 a resolution
26% identity, 75% coverage: 2:318/424 of query aligns to 1:318/319 of 3ingA
- active site: D209 (= D200), K213 (= K204)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G10), T10 (≠ C11), G11 (= G12), N12 (≠ T13), V13 (= V14), D38 (vs. gap), S39 (vs. gap), K57 (vs. gap), C85 (≠ V74), T86 (≠ L75), P87 (≠ V76), A112 (= A102), N113 (= N103), K114 (= K104), A139 (= A129), E198 (= E189), S199 (≠ A190), P302 (≠ S302), T305 (= T305)
3jsaA Homoserine dehydrogenase from thermoplasma volcanium complexed with NAD
26% identity, 75% coverage: 1:317/424 of query aligns to 1:320/321 of 3jsaA
- active site: D212 (= D200), K216 (= K204)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), L11 (≠ C11), G12 (= G12), N13 (≠ T13), V14 (= V14), D42 (vs. gap), S43 (vs. gap), A90 (≠ V74), T91 (≠ L75), P92 (≠ V76), A117 (= A102), N118 (= N103), A144 (= A129), T308 (= T305)
P31116 Homoserine dehydrogenase; HDH; EC 1.1.1.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
30% identity, 36% coverage: 91:241/424 of query aligns to 104:260/359 of P31116
- K117 (= K104) binding
- E208 (= E189) binding ; mutation to D: Increases KM for aspartate-semialdehyde 48-fold and reduces kcat by 50%.; mutation E->L,Q: Loss of activity.
- D219 (= D200) mutation to L: Reduces kcat 150-fold.
- K223 (= K204) mutation to V: Loss of activity.
Sites not aligning to the query:
1tveA Homoserine dehydrogenase in complex with 4-(4-hydroxy-3- isopropylphenylthio)-2-isopropylphenol (see paper)
30% identity, 36% coverage: 91:241/424 of query aligns to 103:259/358 of 1tveA
Sites not aligning to the query:
1q7gA Homoserine dehydrogenase in complex with suicide inhibitor complex NAD-5-hydroxy-4-oxonorvaline (see paper)
30% identity, 36% coverage: 91:241/424 of query aligns to 103:259/358 of 1q7gA
Sites not aligning to the query:
1ebuD Homoserine dehydrogenase complex with NAD analogue and l-homoserine (see paper)
30% identity, 36% coverage: 91:241/424 of query aligns to 103:259/358 of 1ebuD
Sites not aligning to the query:
1ebfA Homoserine dehydrogenase from s. Cerevisiae complex with NAD+ (see paper)
30% identity, 36% coverage: 91:241/424 of query aligns to 103:259/358 of 1ebfA
Sites not aligning to the query:
O81852 Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic; AK-HD 2; AK-HSDH 2; Beta-aspartyl phosphate homoserine 2; EC 2.7.2.4; EC 1.1.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 53% coverage: 93:317/424 of query aligns to 662:909/916 of O81852
Sites not aligning to the query:
- 441 I→A: Loss of threonine sensitivity for the aspartokinase activity and decreased inhibition of homoserine dehydrogenase activity by threonine.
- 443 Q→A: Loss of threonine sensitivity for the aspartokinase activity and decreased inhibition of homoserine dehydrogenase activity by threonine.
- 522 I→A: No effect on the inhibition of aspartokinase activity by threonine, but decreased inhibition of homoserine dehydrogenase activity by threonine.
- 524 Q→A: No effect on the inhibition of aspartokinase activity by threonine, but decreased inhibition of homoserine dehydrogenase activity by threonine.
O94671 Probable homoserine dehydrogenase; HDH; EC 1.1.1.3 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
30% identity, 35% coverage: 63:212/424 of query aligns to 92:239/376 of O94671
- S201 (≠ D174) modified: Phosphoserine
Query Sequence
>206318 MicrobesOnline__882:206318
MKPLVIGMAGCGTVGSGLLRVLEENRQWIVERTGRAVQVKHVLVRDLSKPRDLPDGASLT
DDPAVLTDDPEVDVLVELMGGIEKPRELIRRAIENGKHVVTANKALLAEDGFGLFRLAEE
KGVGLYYEASVAGGIPIVQTLKESLAGNRITSLVGILNGTANHILSEMTSAGLDFETALA
QAQELGYAEADPTLDIDGHDTAHKLVLLIRLAYGLEYPYAEMPVQGIRGIDRMDIEFARE
FGFRIKLLGQVREVDGRLEAGVFPTLVRHTYLIARVGGAYNAIRIEGNAVGPVFLHGQGA
GSLPTASSVLADLMAVARATPPHNTGFQRQVPPKASILPPDDAVSAYYVRVMVPDHPGVL
RDLAGAMADHGISIAQAIQKGQDKRGVPLVFMTHEAGARAISDAIEQIRQAGLLTADPVC
YRVL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory