Comparing 206319 DVU0891 aminotransferase, classes I and II to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2x5dD Crystal structure of a probable aminotransferase from pseudomonas aeruginosa (see paper)
55% identity, 94% coverage: 16:390/397 of query aligns to 1:375/380 of 2x5dD
6l1oB Product bound bacf structure from bacillus subtillis (see paper)
38% identity, 95% coverage: 12:389/397 of query aligns to 12:387/392 of 6l1oB
6l1lB Apo-bacf structure from bacillus subtillis (see paper)
38% identity, 95% coverage: 12:389/397 of query aligns to 12:387/393 of 6l1lB
6l1nA Substrate bound bacf structure from bacillus subtillis (see paper)
38% identity, 95% coverage: 12:389/397 of query aligns to 12:386/393 of 6l1nA
2o1bA Structure of aminotransferase from staphylococcus aureus
33% identity, 88% coverage: 34:382/397 of query aligns to 21:364/376 of 2o1bA
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
31% identity, 96% coverage: 8:390/397 of query aligns to 7:382/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
31% identity, 96% coverage: 8:390/397 of query aligns to 7:382/382 of 1bjwA
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
31% identity, 96% coverage: 8:390/397 of query aligns to 7:382/385 of Q56232
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
31% identity, 96% coverage: 8:390/397 of query aligns to 7:382/382 of 1b5oA
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
29% identity, 90% coverage: 33:391/397 of query aligns to 26:383/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
29% identity, 90% coverage: 33:391/397 of query aligns to 26:383/388 of 1gd9A
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
30% identity, 96% coverage: 8:390/397 of query aligns to 7:382/382 of 1gc4A
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
30% identity, 96% coverage: 8:390/397 of query aligns to 7:382/382 of 1gc3A
1j32A Aspartate aminotransferase from phormidium lapideum
28% identity, 97% coverage: 8:392/397 of query aligns to 6:386/388 of 1j32A
Q58097 (5-formylfuran-3-yl)methyl phosphate transaminase; 4-HFC-P:alanine aminotransferase; EC 2.6.1.108 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
28% identity, 93% coverage: 23:391/397 of query aligns to 20:369/370 of Q58097
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
30% identity, 92% coverage: 27:392/397 of query aligns to 32:384/384 of 1o4sB
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
28% identity, 91% coverage: 28:389/397 of query aligns to 31:394/402 of P14909
Sites not aligning to the query:
6f35A Crystal structure of the aspartate aminotranferase from rhizobium meliloti (see paper)
28% identity, 91% coverage: 27:386/397 of query aligns to 26:392/400 of 6f35A
P58350 Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
28% identity, 91% coverage: 27:386/397 of query aligns to 36:402/410 of P58350
2o0rA The three-dimensional structure of n-succinyldiaminopimelate aminotransferase from mycobacterium tuberculosis (see paper)
30% identity, 96% coverage: 9:389/397 of query aligns to 3:383/385 of 2o0rA
>206319 DVU0891 aminotransferase, classes I and II
MSQSQFPRMHRLPPYVFAVVNELKMQLRRQGVDIVDLGMGNPDMPTPQHIVDKMVEASMK
GNNHRYSVSRGIPNLRKAICDWYTRRFGVYLDPDTEAVVTMGAKEGLSHLSLAMLSPGDV
VFAPDPTYPIHTYAPVIAGADVRRIPIGRGRDFFEDLLVATRQTWPQPKLLFLSYPHNPT
TELATPEFFQKVVDFAKEHKIYVIHDFAYADLAFDGHMPPSFMQADGAKDVGVEFFSMSK
SYSMAGWRVGFCVGNREMVNTLTRIKSYLDYGIFQPIQIAATVALNGPQECMTEIVDTYR
KRRDVLIEGLNRSGWEVPAPKGTMFVWAQIPEPFRAMGSVEFSKLLLREAHVAVSPGLGF
GAHGDDHVRFALIENEQRTKQALRGIRHLLSGKPCGE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory