Comparing 206361 MicrobesOnline__882:206361 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
42% identity, 96% coverage: 11:375/380 of query aligns to 1:365/367 of P0A7B5
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
43% identity, 96% coverage: 13:375/380 of query aligns to 1:363/365 of 2j5tD
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
39% identity, 96% coverage: 13:375/380 of query aligns to 1:323/325 of 2j5vB
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
39% identity, 96% coverage: 13:375/380 of query aligns to 1:321/323 of 2j5vA
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
34% identity, 57% coverage: 15:231/380 of query aligns to 1:205/241 of 2akoA
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
33% identity, 67% coverage: 11:263/380 of query aligns to 9:233/236 of 7f5xA
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
33% identity, 67% coverage: 9:263/380 of query aligns to 7:255/258 of 7wx3B
>206361 MicrobesOnline__882:206361
MEWTEERAAALREARCVVVKVGSAVLTTETGVNLAVIDSLAAQLSALQESGKRVVLVSSG
AVAAGRSALRDCCEIAGMPHKQAASAVGQSRLMHHYDEAFARYGHLSAQVLLTRDDLRNR
ERFLNARNTFQALLDWGVIPVVNENDTVAVQELKFGDNDCLASLLLNVVEGDLYVNLTSA
SGVYADNPQTNPEAGILPCIEDVHTLDLDVMCGGKTSVGTGGMYSKLLAASRAAQLGVPT
LILPGREPRILERAFSGEPVGTWVRPEARVVSRRKYWLAYQSEPSGTVTVDEGAARALLQ
QGGSLLPGGVCDVSGAFEPGALVRIAGPDGTVIAVGLSNYGDRDLVRIKGHRRHEVAAIL
GDAHFPEVVHRDNMLLDAVV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory