Comparing 206396 MicrobesOnline__882:206396 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
Q54VI3 Glutamate dehydrogenase 2; NAD-specific glutamate dehydrogenase; NAD-GDH; EC 1.4.1.2 from Dictyostelium discoideum (Social amoeba) (see paper)
33% identity, 55% coverage: 389:934/997 of query aligns to 478:1026/1042 of Q54VI3
1v9lA L-glutamate dehydrogenase from pyrobaculum islandicum complexed with NAD (see paper)
28% identity, 35% coverage: 455:800/997 of query aligns to 53:354/418 of 1v9lA
6yeiA Arabidopsis thaliana glutamate dehydrogenase isoform 1 in complex with NAD (see paper)
25% identity, 33% coverage: 562:888/997 of query aligns to 140:407/409 of 6yeiA
Sites not aligning to the query:
6yeiF Arabidopsis thaliana glutamate dehydrogenase isoform 1 in complex with NAD (see paper)
25% identity, 33% coverage: 562:888/997 of query aligns to 141:408/410 of 6yeiF
Sites not aligning to the query:
6yehA Arabidopsis thaliana glutamate dehydrogenase isoform 1 in apo form (see paper)
27% identity, 24% coverage: 562:800/997 of query aligns to 140:346/410 of 6yehA
Sites not aligning to the query:
8owmC Crystal structure of glutamate dehydrogenase 2 from arabidopsis thaliana binding ca, NAD and 2,2-dihydroxyglutarate (see paper)
24% identity, 35% coverage: 454:800/997 of query aligns to 54:349/413 of 8owmC
Sites not aligning to the query:
P50735 Cryptic catabolic NAD-specific glutamate dehydrogenase GudB; NAD-GDH; EC 1.4.1.2 from Bacillus subtilis (strain 168) (see paper)
27% identity, 24% coverage: 562:800/997 of query aligns to 158:364/427 of P50735
Sites not aligning to the query:
P80053 Glutamate dehydrogenase 2; GDH-2; EC 1.4.1.3 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
25% identity, 34% coverage: 465:800/997 of query aligns to 73:355/420 of P80053
Sites not aligning to the query:
4xgiA Crystal structure of glutamate dehydrogenase from burkholderia thailandensis
25% identity, 24% coverage: 562:800/997 of query aligns to 151:358/416 of 4xgiA
Sites not aligning to the query:
3aogA Crystal structure of glutamate dehydrogenase (gdhb) from thermus thermophilus (glu bound form)
26% identity, 27% coverage: 562:834/997 of query aligns to 150:394/421 of 3aogA
Sites not aligning to the query:
3aoeB Crystal structure of hetero-hexameric glutamate dehydrogenase from thermus thermophilus (leu bound form)
26% identity, 27% coverage: 562:834/997 of query aligns to 153:397/424 of 3aoeB
Sites not aligning to the query:
P00370 NADP-specific glutamate dehydrogenase; NADP-GDH; EC 1.4.1.4 from Escherichia coli (strain K12) (see 2 papers)
26% identity, 20% coverage: 606:801/997 of query aligns to 211:384/447 of P00370
Sites not aligning to the query:
>206396 MicrobesOnline__882:206396
MTDASRSGTATALHEDAVSGSAAAEALDLVRRGLDDMAGQVVPWFFGNMPEYYLRTHSVT
EKVHHLQAIISGRAVTGSQTVRLMAPDGRKATYLVPGGGTKELLTILEAHVAQEIETARL
YTTQDGQLHLVEFLFGEQPRAEVAGDLFAEAVSAMRGEGVSGDRIDLFERMLRGANAEYL
EKFDPQRALRHLHMLESVGRSEDTAILLEQCTPGSETRLVMAMRHPPATGLLLQTAKILA
RTGVTVNRCYGDSFNLDDGDSVAILSFYVNVGGDILHEDSELWQRLRRKLQLVKWFAPNP
FESYADREGWSLKRVMLLAAAAEFAHAFLVQENQWAYSTNNVTRILQERRGEVARLVAWF
EARFDPTLGGREAKARELDEAALAAVGDVADESERTVLLMVHRFFAFTLRTNYFLEDVYG
LSFRLDPQFLPAPCRIEGEELPYGIFFFHGPYCMGFHIRYRDMSRGGVRVVPTRSAEQFE
LESNRLYDEVKGLAYAQQVKNKDIPEGGSKAVILLGPLGDIRLAVASMGNSLLDVILCGE
SSPTLPGVVDHLGKEEIIYLGPDENITPEHITWIVERARQRGYRWPSAFMSSKPGAGINH
KQYGVTSLGVMVFAEEVLRHLGIDPAAQPFTVKITGGPKGDVAGNLMRIMFRDYGDNARV
VAVTDGHGAAYDPEGLDRAELMRLVDGQRSIDSFDAALLRGEGAFVVSARDPETVRLRNA
LHNTARADIFIPSGGRPNTINMRNWHEFFDGDGVPTARAIVEGANLFVSPDARKRLAERG
VLVVHGSSANKTGVICSSYEVLGGLVMTDGEFIAAKERYVADVFDILRRRARDEARLLLA
ELRRCDRCKPLHVISVEASQEMNHAADALYGAFMQRQLDIAEDSLWRGLVLDYCPAVLVE
KFRDRIFDMVPRRHLYALIAAYAASAIVYAEGMGWLAGVGTQRDIVDVVRNWHEARALML
RLATAVESTDMEQSAQVAHLLRHGGVRRFTEERLGLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory