Comparing 206398 DVU0966 amino acid ABC transporter, periplasmic amino acid-binding protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
60% identity, 84% coverage: 39:267/272 of query aligns to 3:231/234 of 3k4uE
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
54% identity, 86% coverage: 31:263/272 of query aligns to 1:229/229 of 5t0wA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
42% identity, 84% coverage: 33:261/272 of query aligns to 3:226/229 of 6svfA
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
40% identity, 82% coverage: 39:261/272 of query aligns to 3:222/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
40% identity, 82% coverage: 39:261/272 of query aligns to 3:224/226 of 4zv1A
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
33% identity, 83% coverage: 40:264/272 of query aligns to 1:224/224 of 4ymxA
7a99B Crystal structure of the phe57trp mutant of the arginine-bound form of domain 1 from tmargbp (see paper)
54% identity, 33% coverage: 33:123/272 of query aligns to 2:92/130 of 7a99B
Sites not aligning to the query:
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
27% identity, 85% coverage: 32:261/272 of query aligns to 5:229/237 of 3vv5A
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
27% identity, 85% coverage: 32:261/272 of query aligns to 9:233/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
27% identity, 85% coverage: 32:261/272 of query aligns to 9:233/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
27% identity, 85% coverage: 32:261/272 of query aligns to 9:233/241 of 3vvdA
5kkwA Crystal structure of sar11_1068 bound to a sulfobetaine (3-(1- methylpiperidinium-1-yl)propane-1-sulfonate)
31% identity, 85% coverage: 30:261/272 of query aligns to 1:231/237 of 5kkwA
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
29% identity, 83% coverage: 38:262/272 of query aligns to 1:221/226 of 8eyzA
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
33% identity, 73% coverage: 64:261/272 of query aligns to 38:233/243 of 5eyfB
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
32% identity, 81% coverage: 44:262/272 of query aligns to 18:234/235 of 4g4pA
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
30% identity, 80% coverage: 44:261/272 of query aligns to 9:223/235 of 2pvuA
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
30% identity, 80% coverage: 44:261/272 of query aligns to 5:219/231 of 2q2cA
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
30% identity, 80% coverage: 44:261/272 of query aligns to 15:229/241 of 2q2aA
4h5fA Crystal structure of an amino acid abc transporter substrate-binding protein from streptococcus pneumoniae canada mdr_19a bound to l- arginine, form 1
27% identity, 87% coverage: 30:266/272 of query aligns to 1:239/240 of 4h5fA
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
27% identity, 85% coverage: 31:262/272 of query aligns to 42:271/287 of 6h20A
>206398 DVU0966 amino acid ABC transporter, periplasmic amino acid-binding protein
MKLFRLLAAMMMAALLAAPAMAADIELAKKSTLNEIMARGELRVGFDAGYLPFEMTDKNG
NYVGFDIDIAKEMARAMGVKFVPVNTDFDGMIPALLSDKFDIIISGMTVTQERNLKINFA
DPYIVVGQTVLLSKKLEGKVKSWKDLNSPEYTVVSRLGTTGEEAAKRMLPKAKFKSFDKE
ADGALEVVNGRADAWVYDMPFNVVFMAEQGKDKVVHLDKPFTYEPLGFGIKKGDPDFLNF
LNNFMRQIKNDGRYDRIYDKWMRSTEWRSQTN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory